(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE270

PENCW_13.PE270       Location/Qualifiers
FT   CDS_pept        join(complement(610206..610312),complement(609238..609955),
FT                   complement(608593..609171),complement(607565..608527))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947670"
FT                   /orf_name="Pc16g02700"
FT                   /product="Pc16g02700 protein"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP92940.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001831B19"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7I6"
FT                   /transl_table=1
FT                   /translation="MRRKHGGHSRIAIETSSNTKEPISNVVVSVSAGKLKQGKSRFIEP
FT                   QDKSDQNTSRSPKLYTRSHQEDVPEDQNGHKGLPDESITPFSGETSLAHNMTVVEDRLE
FT                   QMGVRYARLRSESPNHSFSSQLTPSPQASPKGNRPQQTKSYVYQALDSHKIVPDRVQWD
FT                   RAMKTFCDEVHILVPFLHLPSVWEAYERLWESFLVPSANHYSRGEWRFTFACVLLCLAN
FT                   GTCVESSRVDGQQGQYSAGWSLYRAARDVIGDLLDVFGECTDQILLLQNILLMVIYLFR
FT                   LDSHGPAEKLLALSISHSHHIGLQRRQVVEAMNPFESEMARRLWWCIYLMDRRLAIETG
FT                   RPFLIQDLNVDIGLPRSMSDEWLSKHRGTSHPLQPEDTATGNSPTTVPYLIAMASYSKV
FT                   IGKVWEALYGASTSDSTPSPFLKEYLELLITQSQSDLQPEFSYDPQRPGSYRARGLAWW
FT                   QIKQQLMMRIRWSSLYLLIRKPMLQRKGASSLPVPEAIENEVICMRLAQSIIEDFSNVA
FT                   EDHPKYTFPFLHYLTSATIIALGLIIKQSSFKHTYGELTLEAARSLKKHCRKTWVSGRM
FT                   ARAVWKLNQMAEAIMNPGPRLTENLGSNDQQSSSSRPMSSSNHLSHESPKTCDNALQER
FT                   VQFNLSSSDCLADSTLSASCRRTQIRQAIDRDPPVAGHMDLDESPFMPNDFPFEERHTP
FT                   AHTSGHRPPRHHPHELHSGGVQTAGMEPGLPGDTNDTDPNTGVLSTSLPISGMDMIGSD
FT                   QNAWLPGEMIDGGIEWLQELFVSDLDSHVPSAWNW"
     atgcgtcgaa agcatggtgg gcattccagg attgcgattg aaacttccag caatactaaa        60
     gaacccattt caaatgtagt ggtcagtgta agcgccggaa aattaaagca aggaaagtca       120
     agattcattg aacctcaaga taagagtgat cagaacacct cgaggtcgcc aaaattgtac       180
     actagaagcc atcaagaaga tgtccctgaa gatcaaaatg ggcataaagg attgccagac       240
     gagagtataa caccattctc cggtgagacc tctctagcac acaacatgac cgttgtggaa       300
     gacaggctag agcagatggg cgtgagatat gctagacttc gatctgaatc gcccaatcac       360
     tcgttctcct cccagttgac accgtctccg caagcatcgc ccaagggaaa tcgcccacaa       420
     cagactaaga gctatgtata tcaagctcta gactcccata aaatagtacc agatcgcgta       480
     caatgggacc gtgctatgaa gaccttttgt gatgaagtcc atattctggt tcccttttta       540
     cacttgcctt cagtgtggga agcatatgaa agactgtggg aaagcttcct cgttcccagc       600
     gcaaatcatt actctcgtgg cgagtggagg tttacttttg cgtgtgtgct gttgtgcctt       660
     gctaatggta catgcgttga gtcttcacgc gtcgatggcc aacaagggca gtactctgcc       720
     ggttggagcc tgtaccgagc ggcaagggac gtaattggag acctcttaga tgtcttcggg       780
     gagtgtaccg atcagatact cttgctacaa aacattttac tgatggttat ctatcttttt       840
     cgacttgatt cccatggacc agcggaaaaa ctcttagccc tttcaatatc ccattcgcac       900
     cacatcggac tgcaacgtcg tcaggtggtg gaagcaatga acccttttga aagtgaaatg       960
     gctcgtcggc tctggtggtg tatatatctc atggacagaa gattagctat tgagactggt      1020
     cgtccattcc tcattcagga cttgaacgtt gacattggcc ttcctcggag tatgagcgat      1080
     gagtggctta gcaaacaccg agggacctct catccgctgc agcccgagga tactgctact      1140
     ggaaactctc ctactacggt accatacctc attgctatgg ctagctactc gaaggtgata      1200
     ggcaaagtct gggaagctct gtacggtgct tcaacgtcgg actcaacccc aagtccattt      1260
     ctcaaagaat atttggaact cctcataaca caatcccaaa gtgatcttca accagagttc      1320
     tcctatgacc cgcaacggcc gggaagctac agagcaagag gattagcgtg gtggcagatc      1380
     aagcagcagt tgatgatgcg gattcgatgg tcgtcacttt accttctgat cagaaagcca      1440
     atgcttcagc gtaaaggagc ttcatctttg ccagtaccag aagccatcga aaacgaagtg      1500
     atttgtatgc gcctagccca gagcataatc gaagacttca gcaacgtggc agaagatcat      1560
     ccaaagtaca cttttccatt tctgcactac ctgaccagtg ctacaattat tgcgctcggg      1620
     ttgatcatca aacaaagttc tttcaaacat acctatgggg aattgacgtt ggaagccgcg      1680
     cgatcactga agaaacactg ccgcaagacc tgggtctcag gcagaatggc ccgggctgtc      1740
     tggaagctaa accaaatggc tgaagcaatc atgaacccag ggcctcgatt aaccgaaaac      1800
     ttggggagca acgatcaaca gtcgtcttcg tcgcgaccca tgagctcatc gaaccattta      1860
     tctcatgaat caccaaagac ttgcgataac gcgttgcaag agagagtgca atttaactta      1920
     tcaagttcgg attgccttgc agattcaacg ttgtctgctt cctgtcgccg aacacaaatt      1980
     cgtcaagcca ttgatcgaga cccaccagtc gcgggacaca tggatctaga cgaaagtcct      2040
     tttatgccaa acgattttcc ttttgaagag agacacacac cagcccatac atccggtcac      2100
     cgtccgccaa gacatcatcc tcatgaactg cactctggtg gtgtacaaac agcgggaatg      2160
     gagcccggtc ttccaggtga tacaaatgat acggacccta acacgggggt cctttcaact      2220
     tcattaccta tctcaggaat ggatatgata ggctcagatc agaacgcctg gttacctggt      2280
     gaaatgatag atggtggaat agagtggcta caggaattat ttgtgagcga tctggattca      2340
     catgttccat cggcttggaa ttggtag                                          2367
//

If you have problems or comments...

PBIL Back to PBIL home page