(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE274

PENCW_13.PE274       Location/Qualifiers
FT   CDS_pept        join(complement(615978..616128),complement(615614..615736),
FT                   complement(615472..615527))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671651"
FT                   /orf_name="Pc16g02740"
FT                   /product="Putative uncharacterized protein Pc16g02740 "
FT                   /protein_id="CAP92944.1"
FT                   /db_xref="UniParc:UPI0001831B1B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7I8"
FT                   /transl_table=1
FT                   /translation="MNVPKSRNLFPRVQAGLYTYCSAGIVGFARPRKEKVLVPQRFSNG
FT                   LGAGGGILYYQSMLLGYGPGIGNVQGPTVAPETLTALASQWGLGAKGKTQVDSLLPYPA
FT                   SSLPV"
     atgaatgttc caaagtcaag gaatctgttc cccagggtcc aggcgggact ttatacctac        60
     tgctccgccg gcatagtagg gtttgcgagg ccaagaaaag agaaagtctt ggtgccccaa       120
     aggttctcaa atggccttgg cgccggaggg ggtatccttt actatcagtc gatgttgttg       180
     ggttatggtc ccggaattgg aaacgtgcaa ggtcctacgg ttgcacccga gaccctgacc       240
     gcgctagcta gtcaatgggg gctgggggcg aaagggaaga cgcaggtgga tagcttgttg       300
     ccctatcccg cctcatctct cccggtctag                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page