(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE275

PENCW_13.PE275       Location/Qualifiers
FT   CDS_pept        join(616170..616279,616344..616773)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000169475" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128679"
FT                   /orf_name="Pc16g02750"
FT                   /product="Pc16g02750 protein"
FT                   /protein_id="CAP92945.1"
FT                   /db_xref="UniParc:UPI0001831B1C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7I9"
FT                   /transl_table=1
FT                   /translation="MKLSIFLIALMTSVSSAQDPGPSPTASVGCEPHGDHWHCDGPAST
FT                   DVSSVTSTSAAEVSTTASPTMPSPTESVGCEPHGDHWHCDGPAETGTEAEASTTSATAS
FT                   PTMPSPTESVGCEPHGDHWHCDGPAETGSASASASASASASASTSAGDEEGAAGSIGVQ
FT                   VSLLAGLSLVAAGLNL"
     atgaaactgt ccatcttcct cattgcattg atgacctcgg tctcatccgc tcaggacccc        60
     ggcccatctc ctactgcttc tgtcggctgt gaaccacacg gagatcactg gcactgtgac       120
     ggcccagcct caacagatgt ctcctcagtt acatcgacca gcgcggccga agtgagcacc       180
     actgcttctc ccactatgcc tagtcctacc gagtctgttg gctgtgagcc gcacggcgac       240
     cactggcact gcgatggacc cgccgagacc ggtactgagg ccgaagcgag caccacctct       300
     gccactgctt ctcccactat gcccagtcct actgagtctg ttggctgtga gcctcacggc       360
     gaccactggc actgcgatgg accggctgag actggcagtg cctccgcgag tgcctccgcg       420
     agtgcctccg cgagtgcctc taccagcgct ggagatgagg aaggtgctgc tggatcaatc       480
     ggtgtgcagg tttccctgct tgctggtttg tcccttgtcg ctgctggtct gaacctttga       540
//

If you have problems or comments...

PBIL Back to PBIL home page