(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE276

PENCW_13.PE276       Location/Qualifiers
FT   CDS_pept        join(complement(621464..621483),complement(621373..621395),
FT                   complement(621252..621290),complement(621081..621186),
FT                   complement(620882..621015),complement(619558..620809),
FT                   complement(619208..619501),complement(619018..619155),
FT                   complement(618568..618963),complement(618406..618505))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208451" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947671"
FT                   /orf_name="Pc16g02760"
FT                   /product="Pc16g02760 protein"
FT                   /function="acid-amino acid ligase activity"
FT                   /biological_process="protein modification process "
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP92946.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0016881"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR008973"
FT                   /db_xref="InterPro:IPR018029"
FT                   /db_xref="UniParc:UPI0001831B1D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7J0"
FT                   /transl_table=1
FT                   /translation="MASNLPAQPNLRVTIIAADGLYKRDVFRFPDPFAVATVGGEQTHT
FT                   TSVIKKTLNPYWNEPFDLRVNEDSILAIQIFDQKKFKKKDQGFLGVINVRIGDVIDLSM
FT                   GGDEMLTRDLKKSNDNLVVHGKLIINLSSNLTTPHPNQNGLQRQQAQTSTSSGLVPQVA
FT                   APTSQSQAGPSNIDTSPAAASSSSLTQRTSATAPPAGAPPSLNGAPTNPPGPGVPSRTN
FT                   LSSFEDSQGRLPAGYERREDNLGRTYYVDHNTRTTTWSRPSANYNEHAQRSQREANMQL
FT                   ERRAHQSRMLPEDRTGANSPNLPDAQQIPTPPPGPNAGTSLASGAPAGSNAAAISMMAT
FT                   GATTAGTGELPPGWERRVTPEGRPYFVDHNTRTTTWVDPRRQQYIRMYGQGQTTGGANN
FT                   TTIQQQPVSQLGPLPSGWEMRLTNTARVYFVDHNTKTTTWDDPRLPSSLDQGVPQYKRD
FT                   FRRKLIYFRSQPALRIMSGQCHVKVRRNNIFEDSYAEIMRQSASDLKKRLMIKFDGEDG
FT                   LDYGGLSREFFFLLSHEMFNPFYCLFEYSAHDNYTLQINPHSGVNPEHLNYFKFIGRVV
FT                   GLAIFHRRFLDSFFIGAFYKMMLRKKVSLQDMEGVDEDLHRNLAWTLDNDIDGIVELTF
FT                   SVDDEKFGERRTIDLIPGGRDIPVTNENKPQYIELVTEWKIMKRVEEQFDAFMSGFNEL
FT                   IPPDLVNVFDERELELLIGGIADIDVEDWKKHTDYRGYQEQDEVIQNFWKIVRTWDAEQ
FT                   KSRLLQFTTGTSRIPVNGFKDLQGSDGPRRFTIEKSGDPAALPKSHTCFNRLDLPPYKT
FT                   HDALEHKMSIAVEETLGFGQE"
     atggcgtcaa atctcccagc ccagccaaat ctccgggtca cgattatcgc ggctgatggc        60
     ttgtacaaac gcgatgtctt ccgattcccc gatccattcg ccgtggctac tgttggcgga       120
     gagcaaacac acactacttc tgtgatcaag aagactctga atccctattg gaatgagcca       180
     ttcgatttga gagtcaacga ggacagcatt ctcgcgattc agattttcga ccagaagaaa       240
     ttcaagaaga aggaccaggg tttcctcgga gtcatcaatg tccgtatcgg cgatgtcatt       300
     gacttgtcga tgggtggtga tgaaatgctt actcgggatc tgaaaaaatc gaacgataac       360
     ctcgtggtcc acggaaaatt gatcatcaac ctatcttcaa accttaccac cccgcatccg       420
     aaccagaatg gactccagcg tcaacaggcc cagacgtcga cttccagcgg ccttgtaccc       480
     caggttgcag caccaacatc ccagtcacaa gctggcccaa gcaatatcga tacgtcccct       540
     gcggcagcat caagttcatc attgacccag cgcacttcgg ccaccgctcc accggccggt       600
     gcccctccgt cgttgaatgg ggccccgacc aacccccctg gacccggtgt cccctcccgc       660
     actaatctca gttcatttga ggacagccaa ggtcgactcc ctgctggata cgaacggcgt       720
     gaagacaatc tgggacggac atattatgtg gaccacaata cgcgcaccac aacatggtca       780
     cgaccatcgg ccaactacaa cgagcatgcc cagcgctcgc agcgcgaagc caacatgcag       840
     cttgaacgcc gagcccacca gagccgaatg cttccagaag atcggactgg cgccaattca       900
     cccaacctgc cagatgccca gcagatacct acgccaccgc ccgggcctaa cgcaggaact       960
     tctctcgcat ctggagctcc agccgggtcc aacgccgccg cgatctccat gatggcgacg      1020
     ggagccacca ctgcaggcac aggggagctt ccaccaggct gggaacgacg agtgacaccc      1080
     gaggggcggc cctatttcgt ggaccacaac acacgcacga cgacatgggt cgatcctcgt      1140
     cggcagcagt atatccgcat gtacggccag ggacagacca caggtggggc gaacaacacc      1200
     actattcaac aacagcctgt atcccaattg ggtcctctgc ccagcggctg ggagatgcgt      1260
     cttaccaaca ctgctcgagt atatttcgtc gatcacaaca ccaagacgac tacctgggat      1320
     gatccgcgcc tgccgtcctc tttggatcag ggcgtgcccc agtataagcg tgacttccgc      1380
     cgcaagctga tctacttccg gtcccaaccc gcgttgcgca ttatgtccgg acagtgccac      1440
     gttaaagtcc gtcgtaataa catcttcgag gattcgtatg ccgagattat gcgccagagc      1500
     gcatccgatc ttaagaagcg cctgatgatc aagttcgatg gcgaagatgg tcttgactac      1560
     ggtggtcttt cacgtgaatt cttcttcctc ctctcacacg aaatgttcaa tcctttctac      1620
     tgtctcttcg aatactctgc ccacgataat tataccttgc agattaatcc ccattcgggc      1680
     gtgaaccccg agcatctcaa ttacttcaag ttcatcggcc gggtggttgg tctggctatc      1740
     ttccaccgtc gtttcctgga ttccttcttc attggagcct tctacaagat gatgttgcga      1800
     aagaaggtca gtctccaaga tatggagggc gtggatgagg atttgcaccg caacttggca      1860
     tggacactgg ataatgacat tgacggaatt gtggaactca cattttcggt tgacgatgag      1920
     aagtttggcg agcgtcgcac tattgatttg atacccggtg gccgggatat tcccgtcacc      1980
     aacgagaaca agccacagta cattgagttg gtcacggaat ggaagatcat gaagcgagtt      2040
     gaggagcagt tcgacgcctt catgtccggc ttcaatgagc ttatcccgcc cgatctcgtc      2100
     aacgtctttg acgagcgcga acttgagttg ctcattggtg gtattgccga cattgatgtc      2160
     gaagactgga agaagcacac cgactaccgc ggctaccagg agcaggacga ggttatccag      2220
     aacttctgga agatcgtccg cacctgggat gctgagcaga agtcgcgtct tctccagttc      2280
     actactggta cctcacgtat tcccgtcaac ggattcaagg atctgcaggg atctgatggc      2340
     cccaggcggt ttaccattga gaagtctggt gatcctgctg cgcttcccaa gtcgcatact      2400
     tgcttcaacc gtcttgatct tcctccttac aagacgcacg atgctctcga gcacaaaatg      2460
     tctatcgcgg tggaggaaac gcttggcttt ggacaggaat ag                         2502
//

If you have problems or comments...

PBIL Back to PBIL home page