(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE277

PENCW_13.PE277       Location/Qualifiers
FT   CDS_pept        join(complement(623085..623165),complement(622685..622941),
FT                   complement(622532..622619),complement(622325..622474))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208465" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977564"
FT                   /orf_name="Pc16g02770"
FT                   /product="Pc16g02770 protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAP92947.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0001831BED"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7J1"
FT                   /transl_table=1
FT                   /translation="MAAEGQEIPEEIKGEKVPAQEDGVDDEEEIEAMKRRVAEMESEAA
FT                   KLREMQADLDQQTESLQENKEDIDARSIFVGNVDYGASPEEIQAHFQSCGSINRVTILL
FT                   DKFSGQPKGYAYVEFAEPSLVAQALVLNESVFRGRNLKVVPKRTNLPGMHRGRGRGFGR
FT                   GRGRGFPRGGGYRGGAPYRGRGRGFSPY"
     atggctgctg aaggccagga gatcccagag gagatcaagg gggagaaggt tccagcccag        60
     gaagatggtg tagatgacga ggaagagatt gaggctatga agcgacgagt ggccgagatg       120
     gaatccgagg ctgccaagct gcgtgagatg caagccgacc tcgaccagca aactgagagt       180
     cttcaagaga acaaggaaga tattgatgcg cgtagcattt tcgtcggcaa cgttgactac       240
     ggcgcttcgc cggaggagat ccaggctcat ttccagagct gtggttccat caaccgggtt       300
     accatcttgc tggacaaatt ctctggccag cccaaaggtt atgcctacgt tgaatttgcg       360
     gaacccagcc tagttgccca ggccctggtt ttgaacgaga gtgtcttccg cggtcgcaac       420
     ttgaaggtcg ttcccaagcg taccaacttg cccggtatgc accgtggccg tggccgtggg       480
     tttggccgcg gtcgtggtcg tggtttcccc cgtggtggtg gatatcgtgg cggtgctccc       540
     taccggggcc gaggacgtgg cttctcgccc tactga                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page