(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE278

PENCW_13.PE278       Location/Qualifiers
FT   CDS_pept        join(complement(625021..625077),complement(624481..624894),
FT                   complement(624312..624428))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000293431" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977565"
FT                   /orf_name="Pc16g02780"
FT                   /product="Pc16g02780 protein"
FT                   /protein_id="CAP92948.1"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="UniParc:UPI0001831BEE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7J2"
FT                   /transl_table=1
FT                   /translation="MTARLVLVIGDLFIPDRAPFRKLLTPGKIGQTLCLGNLTDRETYD
FT                   FLREVAPDLQMVKGDYDVDSPNLPLSRIVNHGSLRIGFTHGHTIVPPADADALLIAARQ
FT                   MDVDVLLWGGTHRFEAFEMEGRFFINPGSATGAMSSGFWPDGEEPTPSFCLMDIQGDVL
FT                   VLYVYQLKTDANGVENVAVEKVSFRKNHPPAS"
     atgaccgccc gtttggtctt ggtcattggt gacctgttca tccctgaccg agctcctttc        60
     cgcaaactcc tgacccccgg caagatcggc cagacccttt gtctgggcaa cttgactgat       120
     cgcgagacct atgatttcct ccgcgaggta gccccggacc tacagatggt caagggtgat       180
     tacgatgtcg actcccccaa tctccctctc tctaggatcg tgaaccatgg cagtctacga       240
     attggtttca cccatggcca caccatcgtg ccacccgccg acgccgacgc actgcttatc       300
     gcggcccgcc aaatggatgt cgatgtccta ctgtggggtg gtacccaccg ctttgaggca       360
     ttcgagatgg aaggtcggtt cttcatcaac ccgggaagcg caacaggtgc catgagctca       420
     ggcttctggc cagatggcga ggagcctaca ccgagtttct gcctgatgga catccaaggt       480
     gatgtccttg tgttgtacgt ctaccagctg aagaccgatg ccaatggggt ggaaaatgtg       540
     gctgttgaga aggtctcctt ccgcaagaac catcccccag cttcgtga                    588
//

If you have problems or comments...

PBIL Back to PBIL home page