(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE279

PENCW_13.PE279       Location/Qualifiers
FT   CDS_pept        join(626252..626340,626397..627465)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000171814" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947672"
FT                   /orf_name="Pc16g02790"
FT                   /product="Pc16g02790 protein"
FT                   /function="catalytic activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /protein_id="CAP92949.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniParc:UPI0001831BEF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7J3"
FT                   /transl_table=1
FT                   /translation="MSAQAPHNTLLIPGPIEFDDAVLQSMSHYAESHVAPGFVKVFGET
FT                   LTLVRKLFQSTNPTAQPFIIAGSGTLGWDLVSANLIERGENALVLNTGYFGDSFGQCLE
FT                   TYGANVTHLKAPIGDRTPLEQVEQALKEKPYKLITLTHVDTSTGVLGDVKGVAQLVRRV
FT                   SPNTLVVVDGVCSVGSEEIAFDEWDLDAVVTASQKAIGCPPGLSIVMTSGRAIQAAQSR
FT                   KTPPGAYYASIANWLPIMQNYENNKPSYFATPPTQLVHALHTTLTQITADVPGRFAIHT
FT                   EVSDKVKAAVAELGLKQVASYPECQAHGMTAMYLPEGLVPADVLPGLLKRGVIFAAGLH
FT                   KEIATKYIRFGHMGVTVTDPKRGDVDKALAALKEALAEAKQAKGL"
     atgtctgctc aagcccctca caacaccctc ctgatcccag gacccatcga attcgacgat        60
     gccgtccttc aatccatgtc ccactacgct gagagccacg tcgctcccgg cttcgtcaag       120
     gtcttcggcg agaccttgac tctcgtccgc aagctcttcc aatccaccaa ccccaccgcg       180
     cagcccttca tcatcgccgg aagcggcaca ctgggctggg atctcgtctc cgccaacctg       240
     atcgagcgcg gcgagaacgc cctcgtcctc aacaccggct acttcggcga ctccttcggc       300
     cagtgtctcg agacatacgg tgccaacgtg acgcacctca aggcgcccat cggcgatcgc       360
     accccgctcg agcaagtgga gcaagccctg aaggagaagc catacaagct catcaccctc       420
     acacacgtcg atacatcgac aggtgtgctc ggggacgtca agggcgtggc ccaattggtg       480
     cgccgcgtca gcccgaacac cctcgtggta gtggacggcg tgtgcagcgt gggctcagag       540
     gagatcgcct tcgacgagtg ggacctcgat gccgtcgtca cggcttcgca gaaggccatc       600
     ggctgcccgc ccggcctcag catcgtcatg acatccggcc gcgccatcca ggccgcccag       660
     tcgcgcaaga ccccgcccgg cgcttactac gcctccatcg ccaactggct tcccatcatg       720
     cagaactacg agaacaacaa gccctcttac ttcgccactc cgcccaccca gctcgtccac       780
     gctctgcaca ccaccctcac ccagatcacc gctgatgtcc ccggccgctt cgctatccac       840
     accgaggtct cggataaggt taaggctgct gttgccgagc ttggtctcaa acaggtcgct       900
     tcttaccctg aatgccaggc tcatggtatg actgccatgt acctgcctga gggtctggtc       960
     ccggctgatg tcctgcctgg tctgcttaag cgtggtgtta tctttgcagc tggcctgcac      1020
     aaggagattg ctactaagta catccggttc ggccacatgg gtgtcactgt cactgatccc      1080
     aagcgtggtg atgtcgacaa ggccctggcg gcgctcaaag aggctctcgc cgaggccaag      1140
     caggccaagg gtctgtaa                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page