(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE280

PENCW_13.PE280       Location/Qualifiers
FT   CDS_pept        join(628343..628470,628565..628666,628728..629085)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824331"
FT                   /orf_name="Pc16g02800"
FT                   /product="Pc16g02800 protein"
FT                   /protein_id="CAP92950.1"
FT                   /db_xref="UniParc:UPI0001831BF0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7J4"
FT                   /transl_table=1
FT                   /translation="MHYLNSTLPFLLAAATFTLADTAATTTTTSADNAVNTTSASENII
FT                   LQECIQSVRSNLGNCAPDDWDCRCTNSMDVVDCYTNCREDTSKKDAETTRQRDCANAKA
FT                   HASISVATSTVSSSRAAATGTDIDDGTDISDSEVETDSEGDSINSYSGLEANLFVRPEE
FT                   GAASGLRMRGWLRFLGHAPGVSLLVLGAGLRF"
     atgcattact tgaactcgac acttccattc ctcctagcag ccgctacttt cacattagcg        60
     gacacagcag caacaaccac aaccacatca gcagacaatg cagtgaatac tacatctgcc       120
     tcagaaaaca tcatcctaca ggaatgcatc caatcagtga gatctaacct gggtaactgc       180
     gcacccgatg attgggactg ccggtgtact aatagcatgg atgtggtgga ctgctatacc       240
     aactgtcgcg aagacacatc caaaaaagat gccgagacga ctcgccaacg ggattgcgct       300
     aatgccaaag cacacgcgtc gatatcagta gctacatcta ctgtaagctc tagtagagcc       360
     gcggctacgg gcactgatat tgatgatgga acggatattt ctgattccga ggttgagact       420
     gattccgagg gagattcgat aaattcgtat agtggattgg aggctaattt gtttgtccgt       480
     ccagaagagg gagctgcttc tggattgagg atgcggggtt ggttacgttt tctagggcat       540
     gcacctgggg tttctctttt agttttgggt gctgggttga ggttttag                    588
//

If you have problems or comments...

PBIL Back to PBIL home page