(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE281

PENCW_13.PE281       Location/Qualifiers
FT   CDS_pept        join(complement(629790..630202),complement(629279..629726))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128680"
FT                   /orf_name="Pc16g02810"
FT                   /product="Pc16g02810 protein"
FT                   /protein_id="CAP92951.1"
FT                   /db_xref="UniParc:UPI0001831BF1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7J5"
FT                   /transl_table=1
FT                   /translation="MEPTTSEHEPKTTKWDEGQIYVKACHNATRKLLVCLLSRSNEKKL
FT                   NLTTAGLDLSSGDSPDYGPRFVKPFSHDKMREYVEREQPWDDRWDIHSLCIPDEPELYK
FT                   YRLWRNAHHVAGILHLTLENFWGYDWPHGLVDEDNELGSLYRNQSQWYLEGWTIAKDTS
FT                   QPHINAFVSDSQPHRVGRLNSGEVSLAYGLIAKRRLQEGYNDHRYIPITMFSMSNFTVR
FT                   ILQIWHDKQNPKALQVRSSRIMDFKGGIQNNLDDWITILCWMTGEPVGDTKNGTEVAKV
FT                   IEREE"
     atggagccca ccacatcaga gcatgagccc aaaacaacaa agtgggatga aggccagatt        60
     tacgtcaaag cctgccacaa cgctactaga aagctccttg tctgcctcct ctctcgctcc       120
     aacgagaaga aattgaacct caccaccgct ggactagact tgtcctccgg tgattcccca       180
     gactatggtc cacgctttgt gaagccattt tcccatgata aaatgagaga atatgtggag       240
     cgtgaacagc cttgggatga tagatgggac atccacagtc tctgtatccc cgatgaacca       300
     gagttgtaca aataccggct gtggcgtaac gcgcaccatg tggctgggat tctgcacctt       360
     actctggaaa acttttgggg ctatgattgg ccgcatggac tagttgatga ggacaacgag       420
     ctcggctcct tatatcgaaa ccaaagccaa tggtacctcg aaggctggac gatcgcgaag       480
     gatacatctc agccccatat caatgccttc gtatccgatt cgcagcccca ccgtgttggt       540
     cgcctcaact caggtgaggt atctcttgcc tatggcttga tcgccaagcg ccgactccaa       600
     gagggataca acgatcaccg gtatatccct atcaccatgt tttctatgtc aaatttcaca       660
     gtccgcatcc ttcagatctg gcacgacaag cagaatccca aagctctcca agtccgttcg       720
     tcacggataa tggacttcaa gggcggtata caaaataact tggacgactg gatcaccatt       780
     ctgtgctgga tgacgggaga gccagtcgga gatacaaaaa atggaactga agttgcgaaa       840
     gtgattgagc gtgaggaata g                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page