(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE282

PENCW_13.PE282       Location/Qualifiers
FT   CDS_pept        join(complement(632540..632932),complement(632248..632481),
FT                   complement(631752..632154),complement(631650..631691),
FT                   complement(631396..631591),complement(631071..631341),
FT                   complement(630977..631018))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671652"
FT                   /orf_name="Pc16g02820"
FT                   /product="Pc16g02820 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP92952.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831BF2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7J6"
FT                   /transl_table=1
FT                   /translation="MDTLIRDSLFGRLSNSLISNKLWPYPNLEACKFETLSTSPTSTIS
FT                   VTPEPSQQFIVEFSGDDDPDMPRNWSLLSKTLVTLDIMLLNFSFYAASAIFTPSIPGIE
FT                   EQFGATTAEGTLGLSLFVIAYGIGPLFLSPLSNLPAIGRTPVYVLGSLIFCLLNIGAAL
FT                   GKNVETILILRFFGGFFGSAPISVGGATLMEVYGPGEAPYAIALYAIFGTLAMFVPSYI
FT                   YALVMVANSHSERWHTWTASLWLLSGITAFTTLFIFFLLPETLSSNILLRRAQRLREHT
FT                   GNPLYRSKSEMDTPTTSFGAMIFKQTVDDLKLSCMDPVIIFVNIHTMLIYGILYLWFEF
FT                   FPFVFDGIYHFTPIQQALAFFGILVGAAISVVSYMLWLRFSYQPRVSKVESSIEPEARL
FT                   VPGQIGAICIPICLFMFAWTSRPGVHWVVPIIGTAFFAPGFYLTFQSVLNYLGESYPRH
FT                   VASVFAGNTFFRSSFGGALPLAAPRMLQSLGIVWASSTLGFISIAMLPLPFILERYGKT
FT                   LRSWSKFAN"
     atggatactc taatccgcga tagcttgttt gggcgcctct caaattcttt aatcagtaac        60
     aagctctggc cctatcctaa tcttgaggca tgcaaatttg agacgctgtc gacttcacct       120
     acgtcgacca tttcggtgac acccgagcct agccaacaat ttatcgttga attctccggc       180
     gacgatgacc cggacatgcc caggaactgg tcactgttgt cgaaaacgct cgtcaccttg       240
     gatataatgc tcctcaattt tagcttctat gccgcttcag caattttcac accaagtatt       300
     cccggtatcg aggagcaatt cggcgccacg actgctgaag gaactctggg gctatcactc       360
     tttgtcattg cctatggcat tgggcctttg tttttgtctc cattgtcaaa tcttccagct       420
     atcggccgca caccagtgta tgtgctggga tctcttatct tctgcctgct aaacatcgga       480
     gccgctcttg gaaagaacgt cgagactatc ctcatacttc gattctttgg tggtttcttt       540
     ggaagtgccc cgataagtgt tggaggagca actctgatgg aagtatacgg gccgggtgaa       600
     gcgccgtatg cgattgcttt atatgctata ttcggaactc tagcgatgtt cgtaccttct       660
     tatatctatg ccctggttat ggttgctaac tcacacagcg agcgttggca cacttggaca       720
     gcaagcttat ggcttctttc tggaattacg gctttcacaa cattgttcat cttcttttta       780
     ttgccggaga ccctgtcttc caatattctt cttcgtcgag cgcaacgcct ccgtgagcat       840
     actggaaatc ctttgtatcg aagcaaatcc gagatggata caccgacgac aagttttggc       900
     gccatgatct tcaagcagac agtggacgat cttaagctat catgcatgga tccggtaata       960
     attttcgtga acatacacac catgctgata tatggaattc tgtatctatg gtttgaattc      1020
     tttccgtttg tatttgacgg aatatatcat ttcactccta tacaacaagc ccttgccttt      1080
     ttcggtatcc tcgtcggcgc agctatatct gtcgtttcat acatgctctg gcttcgattc      1140
     tcctaccagc cccgcgtatc gaaggtagaa tccagtatcg agcccgaagc aaggctagtt      1200
     ccaggacaaa tcggtgccat ttgcattcca atctgtttgt tcatgtttgc gtggacatca      1260
     agaccaggtg tacactgggt ggttccgata attggtaccg ctttttttgc cccaggtttc      1320
     tacctcactt tccagtcggt tctcaattat cttggagaat cgtatccgag acacgtcgcg      1380
     agtgtatttg ccggaaatac cttttttagg agctcatttg gaggtgcatt acctttggct      1440
     gcccctcgga tgctgcagtc tcttggaatt gtctgggcat ccagtacatt gggattcatt      1500
     tccatcgcta tgcttcctct ccccttcatt ctggaaaggt atggaaagac actacgctcg      1560
     tggagcaaat ttgcaaacta g                                                1581
//

If you have problems or comments...

PBIL Back to PBIL home page