(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE283

PENCW_13.PE283       Location/Qualifiers
FT   CDS_pept        join(633685..634368,634418..634969)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171392" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947673"
FT                   /orf_name="Pc16g02830"
FT                   /product="Pc16g02830 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP92953.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR002409"
FT                   /db_xref="UniParc:UPI0001831BF3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7J7"
FT                   /transl_table=1
FT                   /translation="MKVRKQVPPRKKACQSCTDSKVRCGLEKPTCSRCRARGKQCRYPA
FT                   GSGDVHQSSPMVSSEQISADESLTFGLSPANLSATSTVTAFSSPVSGHPSDIPRIYSQH
FT                   ESTQTVDTDLNFDHIDLVPMIDAEKIRDRWLQPYLLTATEQVPKLFNPFTVQFVTCVLR
FT                   SYPNHLLDEKSLPPFIHPLQLNSKAMPRTIANCFSLVRMWMNRVAGSEAIVLSTVRQEM
FT                   ERLSREDATSDFDTLCSFQVYLIYLLTAYFFPIENASLGDDMSMITIQDLAFRVAKAGF
FT                   TCKAELSQTRPTWESWIIASAKRRTLFTMYIFSNVYNSDKGLPNFLSDELGDILVPESK
FT                   ALWEASDRDSWTREYNRHLSKWEDGMLKISELWRSSETGSEARRKRIGRWVQSTDEFGM
FT                   MLFAVCAHIHGC"
     atgaaagtta gaaaacaagt tccaccgcgc aaaaaggctt gccagagctg cacggactcc        60
     aaggttcgat gtgggctcga gaagccgact tgctcgcgat gcagggctcg tggcaagcag       120
     tgtcggtatc ccgcgggttc gggcgacgta catcaatcaa gccctatggt ttcaagtgaa       180
     caaatctcag cagatgagag cctaactttt gggctatcac ctgcaaacct ttccgctacc       240
     tcgaccgtaa cagcgttttc gagtcctgtg tctggccatc catcggatat accgcgcatc       300
     tactctcagc acgaatccac acagacggtg gacaccgatt tgaattttga tcacattgac       360
     cttgtgccga tgatagacgc cgagaagatc cgtgatcgct ggctgcaacc ttaccttctc       420
     accgcgacgg agcaggtccc aaagctgttt aatccgttta ccgtgcagtt cgtcacctgc       480
     gtgcttcgct cataccccaa ccatcttctt gatgagaaaa gcctccctcc attcattcat       540
     ccgctgcaac tcaacagcaa agcgatgccg cgaacaatag caaactgctt ttctctggtg       600
     cgcatgtgga tgaacagagt tgctggaagt gaggcaattg ttttatcgac cgtcagacag       660
     gagatggaga gactatcccg ggaggatgcg acaagtgatt tcgacacatt atgttctttc       720
     caagtatacc tcatctacct actaacagct tacttcttcc caatcgaaaa cgcctcccta       780
     ggagacgaca tgagtatgat aactatccaa gacctcgcct tccgcgtcgc aaaagcaggt       840
     ttcacctgca aagccgagct ttcgcaaacg cggccaactt gggaatcctg gatcatcgcc       900
     tctgccaaac gacgcacgct gttcacaatg tacatcttct cgaatgtgta caactccgac       960
     aaaggtcttc caaatttcct gtctgatgag ctaggggata ttcttgttcc cgagagtaag      1020
     gcactgtggg aggcttctga tcgagactct tggacgagag agtataatcg gcacctgtcg      1080
     aaatgggagg atgggatgct gaaaatttcg gagctgtgga gatcgtcgga gacagggtcg      1140
     gaggcgagga ggaaacggat tgggcgatgg gtgcaatcga cagatgagtt tgggatgatg      1200
     ctttttgcag tttgtgcgca catccatgga tgctaa                                1236
//

If you have problems or comments...

PBIL Back to PBIL home page