(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE287

PENCW_13.PE287       Location/Qualifiers
FT   CDS_pept        641734..642885
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128681"
FT                   /orf_name="Pc16g02870"
FT                   /product="Pc16g02870 protein"
FT                   /protein_id="CAP92957.1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI0001831BF7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7K1"
FT                   /transl_table=1
FT                   /translation="MAAEKRFLVPDEKILSDIFPGVVGLKPSSCNVISNTFDICTFSVQ
FT                   VEVIPLIVRLETEKSETSKSRLATVAALSRLGHLQLNDIVPSIQQIGTATTIDTKVNYL
FT                   VTEYLTGTVLLEDIWNTLDETNQLELVDSVVCAMDKLQKLGDIKNVYKYLTATPYISND
FT                   KTPVAIGGPGIGYFPDIKDFLEGILQKHKRPGCKLLGTDGGLSIQSEYDDIGQIDLSHS
FT                   DLDELQHCVVFCHNDLEPRNILVRKSSSGKYKLAGVIDWEMAGFFPFAYEYGVKDTYLG
FT                   RENLYFSWYTMFKGKASYLLPQMECHTKFIKAVRIIEKSKKKAMSRNVGVRVQEKWIQR
FT                   EKVEESSDIREGWIRKAGEKSQVFTKEDMKELENEVLKELGYI"
     atggctgcag aaaaacgatt tcttgtccca gatgagaaga ttctctctga tatcttcccg        60
     ggtgtggttg gcctcaagcc aagcagctgc aatgtaatct cgaacacgtt cgatatctgc       120
     accttcagcg tccaggttga ggttattcca ctcattgtcc gactcgagac tgaaaagtcg       180
     gagacatcaa aaagtcgcct cgccactgtc gcagctctca gtagactagg gcaccttcaa       240
     ctaaatgata tcgttccgtc aatccagcag attggtacgg cgactaccat agatacgaag       300
     gtcaattacc tcgtgaccga gtatcttacg gggaccgttc tgcttgagga tatttggaac       360
     actctcgacg aaaccaacca gctagaactg gtagactcag ttgtttgtgc tatggataag       420
     cttcagaagc ttggagacat caagaatgtc tataaatatc ttacggcaac cccttatata       480
     tcaaacgaca agactcccgt tgctatcggt ggtccaggaa ttggatattt tccagatatc       540
     aaggatttcc tagaaggaat actgcaaaag cataagagac caggctgcaa gttattgggg       600
     actgatggcg gactttcgat tcagtctgaa tacgatgata tcggccagat cgatctatct       660
     cactcggatc ttgatgaact ccagcattgt gttgtctttt gccacaatga cctcgaacct       720
     cgcaacattc tggtcagaaa gtcatcctct gggaaatata agctggctgg tgtgattgac       780
     tgggaaatgg ccggcttttt cccattcgct tacgaatacg gtgttaagga tacttatctt       840
     ggtcgcgaaa acctgtactt cagttggtat accatgttca aaggaaaggc atcctattta       900
     ttaccgcaga tggagtgtca caccaagttt atcaaagctg tgagaatcat cgagaaatcg       960
     aagaagaaag ccatgtcacg aaatgttggc gttcgagtgc aggaaaagtg gatacaaagg      1020
     gaaaaggtag aggaatcttc cgacatccgt gaaggttgga tccgcaaagc aggggagaaa      1080
     agtcaagtgt ttactaaaga ggatatgaaa gaacttgaga acgaggtcct aaaggaactg      1140
     ggatatattt ag                                                          1152
//

If you have problems or comments...

PBIL Back to PBIL home page