(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE288

PENCW_13.PE288       Location/Qualifiers
FT   CDS_pept        join(643493..643508,643567..643603,643700..645002)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217562" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977566"
FT                   /orf_name="Pc16g02880"
FT                   /product="Pc16g02880 protein"
FT                   /protein_id="CAP92958.1"
FT                   /db_xref="UniParc:UPI0001831BF8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7K2"
FT                   /transl_table=1
FT                   /translation="MAGTGARAVCSVANDASRYGVGCPGYKRPWQFKDEGPRLQKRYQK
FT                   KCSNARTHSEAINSNGIFTKFSIDERVHPALVHQSFISQQPQVFKEFICAAFPTMFFHN
FT                   EFRFGNGFNFADCVVKHFGSKQYHDASVSCLSAEYLGHLTGDPRLHQFGRQEYSKALGA
FT                   IRRALNSEEALSDSLLLAVILLSIYEMNTRTTRDAWVYHSRAVKQLLLRRRTTFCLSGV
FT                   GRVCHFAYRPFLIAAALYEGEPCFLADDNWQDLAAFLRMEDSQKQSEWAFYINVYETIF
FT                   MELVKCPGYIKEAREIVSVTSPKARLLAQRICIAGDRLRTLSDELRSLLASHNQRKEGI
FT                   IFRSFVGPQPNAFPETSPSLLLRAAVTATSILEELFIRLTTPAYAKGESPSSSRGTPQS
FT                   VGVSGAGGPLLDFRFTFELGGRTEKDNPCHFTWLDRVAGSMGLLGAEITYVE"
     atggcaggca ctggagcaag ggctgtttgc tctgtcgcga acgacgcatc gcgatacggt        60
     gttggttgcc ctggatacaa gcgtccctgg caattcaagg atgagggacc ccgtctccag       120
     aagcggtatc aaaagaagtg ttcaaacgct aggacccatt ccgaggctat caacagcaat       180
     ggaatcttta cgaagttttc gatcgatgaa cgtgttcatc cagctttggt ccatcaatcc       240
     tttatcagcc agcagccaca ggtgttcaaa gagtttatct gcgctgcctt cccaacgatg       300
     tttttccata atgaattccg cttcggtaac ggctttaact tcgcagactg cgttgtgaaa       360
     cactttggtt ccaagcaata tcacgatgca tcagtctcgt gtctttcagc agaatacctg       420
     ggccatctca ccggggaccc tagactccac caattcggcc gacaggagta ttcaaaggct       480
     ctaggggcaa tcaggcgagc actaaattcg gaagaggcat tgtcggattc cctgcttctt       540
     gcagttattc ttctctctat ctacgagatg aatacgcgga ctactcgaga cgcttgggtc       600
     taccactcga gggcggtaaa acaactattg ctgaggcgta ggacgacttt ctgtctatct       660
     ggggttggac gcgtctgcca ttttgcatac aggccatttc ttatcgctgc tgcactgtac       720
     gaaggtgagc catgtttcct ggccgacgat aactggcagg acctcgcagc tttcctccga       780
     atggaagact cccagaagca gagcgagtgg gcgttctaca tcaacgtcta cgaaacgatt       840
     ttcatggagc tggtcaaatg tcctggatac attaaagagg cacgggaaat cgtctccgtg       900
     acctctccca aggccaggct tctagcacag cggatttgta tagccggcga ccgacttcgg       960
     acattaagtg acgagttacg atcactactt gcgtcccaca accagcggaa ggaaggaatc      1020
     attttccgta gttttgtggg gccgcagcca aacgcttttc ccgaaaccag cccctcactc      1080
     cttctccgtg ccgctgtcac tgctactagc atcctcgaag aactcttcat ccggttgaca      1140
     acgcctgctt atgcaaaggg agagtctcca tcctccagcc gtgggacgcc acaaagtgtc      1200
     ggcgtatctg gtgctggcgg tccacttctt gattttcgtt tcaccttcga gcttggaggg      1260
     cgcacggaaa aggataaccc gtgccatttt acctggcttg accgggtcgc cgggtcaatg      1320
     gggctcttgg gagcagagat tacttatgtg gagtag                                1356
//

If you have problems or comments...

PBIL Back to PBIL home page