(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE289

PENCW_13.PE289       Location/Qualifiers
FT   CDS_pept        645422..646165
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076657" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824333"
FT                   /orf_name="Pc16g02890"
FT                   /product="Pc16g02890 protein"
FT                   /protein_id="CAP92959.1"
FT                   /db_xref="UniParc:UPI0001831BF9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7K3"
FT                   /transl_table=1
FT                   /translation="MPFSSRHERKPSRGRAHRKAGGSMTGDKDIWELDLERSGEINILQ
FT                   RYRLRQHLRRPSHDDSERPFISHRLYFIEEDLREVVQEEISIKEGLDVLEKCGKEKERL
FT                   DVLNTKYWLLERQWWHYHSCLEDGYELRGFELWRSHPKWYMHRDLIKDCASRQGCCARG
FT                   CGCCLRRKIDPTRAFGVGHCTFECGCCRRARGFEIPEGDKILLKEKCREEIGKLPTHRI
FT                   VRVAIWGLVGDSYDNPFDMIDAPPS"
     atgccgtttt cttcccgtca tgaaagaaaa ccgagccgcg gtcgagcaca cagaaaagcg        60
     ggcgggtcta tgacaggcga taaggacatt tgggagctcg atctcgaacg atctggggaa       120
     ataaatattc tccagagata ccgcttacgt caacacctcc gccgaccctc acacgatgac       180
     agtgagcgcc cttttatctc gcataggctt tactttatag aggaagacct tcgagaagtt       240
     gttcaagaag agatatctat caaagaggga ctcgacgtct tagaaaaatg tggaaaagag       300
     aaagagagac ttgatgttct aaataccaaa tactggcttt tagaacgaca gtggtggcat       360
     tatcattcct gtctagaaga tgggtatgaa ctaagagggt ttgagctatg gcggtcccat       420
     cctaaatggt atatgcaccg cgatctcatt aaagattgtg ctagtcgaca aggatgctgt       480
     gcccgtggat gtggctgttg tcttcgccgc aagatcgatc ctacacgtgc atttggagtt       540
     ggacattgta cttttgagtg tggatgttgt cggagagctc gaggctttga aattcccgaa       600
     ggagataaga tattgctaaa agaaaagtgt cgtgaagaaa taggcaaact tcctacgcac       660
     cgtattgtac gagtcgcaat atgggggctt gtcggtgata gctatgacaa cccgtttgat       720
     atgattgatg cgccaccaag ttag                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page