(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE29

PENCW_13.PE29        Location/Qualifiers
FT   CDS_pept        join(65728..66138,66198..66557)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000133453" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823844"
FT                   /orf_name="Pc16g00290"
FT                   /product="Pc16g00290 protein"
FT                   /protein_id="CAP92699.1"
FT                   /db_xref="UniParc:UPI0001831DB9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6T6"
FT                   /transl_table=1
FT                   /translation="MSVNPVFVFVPGAWHTADSFDVVRDLMHNRGLATEAISTPSVGAF
FT                   PPDKGLHADIEHTHAVLKEMVEAGCQIVLVNHSYGGMVGAGAVKGLGYTERRKAGLPGG
FT                   VIMVVWMAAFVTPKGKTLMDMLGGKHAPWMVINSPDDGYCWSSDQETIFYNDMSPEAQQ
FT                   EAISKLKPHTYRSFNEPATHEPWREMPSMYMFFDKDGAISLAVQENFAQTLGNPVTYHV
FT                   DASHSAFLSVPEKVIEGLEIALKEGRQQSGIAVN"
     atgtctgtga accccgtatt tgtgtttgtg ccaggcgcgt ggcacacggc agactcgttt        60
     gacgtcgtgc gggatctgat gcacaaccgt ggacttgcaa ccgaagctat ctccacccca       120
     tctgtgggcg cattccctcc agataagggg ctacacgccg atatcgaaca tactcatgcc       180
     gtcctcaagg agatggtaga agccggatgc cagatcgtgt tggtgaacca ttcctatggt       240
     gggatggtcg gcgctggcgc tgtcaagggc ttggggtaca cggagcggcg caaagccggt       300
     cttcccggcg gagtaatcat ggtagtgtgg atggccgcat ttgtgacgcc caagggcaag       360
     acgttaatgg acatgcttgg cggaaaacac gccccctgga tggtcatcaa tagcccggat       420
     gacggatact gctggtcctc tgaccaagag acaatattct ataacgacat gtctcctgaa       480
     gcgcagcagg aggccatttc caaattgaag ccgcacacgt ataggtcgtt caacgaaccg       540
     gccacgcatg aaccttggcg tgaaatgcct agcatgtata tgttctttga caaggacgga       600
     gctatctcgt tggctgtgca agagaacttt gctcagacct tgggcaaccc agtgacttac       660
     catgtcgatg catctcactc cgcattcttg agtgtgccag aaaaggtgat tgaggggttg       720
     gagattgcgt tgaaggaggg ccgacagcag agtgggattg ctgtgaatta a                771
//

If you have problems or comments...

PBIL Back to PBIL home page