(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE290

PENCW_13.PE290       Location/Qualifiers
FT   CDS_pept        join(646701..646875,646923..647145,647210..647441)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128682"
FT                   /orf_name="Pc16g02900"
FT                   /product="Putative uncharacterized protein Pc16g02900 "
FT                   /protein_id="CAP92960.1"
FT                   /db_xref="UniParc:UPI0001831BFA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7K4"
FT                   /transl_table=1
FT                   /translation="MEDAKEVVAKHRWNGYKRLKRAVRKFLGNNIDRRQLQEATDQIDA
FT                   SETKFPTVAITTLSVFADVFFGLFLTHPFSPSASPPHNEESMALEVLHLADKRGPILAL
FT                   EVGGVVFLVLVLMRTLSLVYWYIRLKILLKLDPDGRYDNDTRWTVIDTLTDMEASQDPM
FT                   KASLPYSLDDEGLYFHPSDAEPSLCLPKSMTKKVFALVHDDQGHCI"
     atggaagatg ccaaagaggt cgttgccaag catcgctgga atggctataa acgattgaaa        60
     cgcgctgtgc gaaaattcct cgggaataat attgaccgcc gtcagctgca agaagcgacg       120
     gatcagattg acgcctcgga aaccaagttt ccgacggttg ctatcaccac gttgagtgtc       180
     tttgcagacg tcttttttgg cctgtttctg acacatcctt ttagccccag tgcctctcca       240
     ccccacaatg aggagtctat ggccctcgaa gtcctccacc tggccgacaa acgggggcca       300
     atacttgccc tcgaagtggg cggcgttgtg ttcttagtcc tggtcctgat gaggacacta       360
     agcctcgttt actggtatat ccggctgaag atcctactca aacttgaccc cgacggtcgt       420
     tacgacaatg acacccgttg gacggtgatt gacacactca ccgacatgga agcgtcccag       480
     gacccgatga aagcaagttt gccttactca ctcgacgacg agggcctcta cttccatccg       540
     tccgacgctg aaccatcctt atgtctgcct aagtccatga cgaagaaggt tttcgctctg       600
     gttcatgacg accaaggcca ttgtatataa                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page