(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE291

PENCW_13.PE291       Location/Qualifiers
FT   CDS_pept        join(648289..648719,648778..649444)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208429" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128683"
FT                   /orf_name="Pc16g02910"
FT                   /product="Pc16g02910 protein"
FT                   /protein_id="CAP92961.1"
FT                   /db_xref="UniParc:UPI0001831BFB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8P9"
FT                   /transl_table=1
FT                   /translation="MAKETKTRTLNVQPEKSQGEDDNKHVSFHPRQITLETFRNLLYQY
FT                   PSTVERVHRSKLMIKLQSKGKAKAPKRKAETKTSAAPATKADLDPSEEKHILEESDQFL
FT                   QLDRWRYEVLPKLIAERANGSAEGAHLVKEELIDIMEWKTKHGVSRPMLMGMVKSNPAT
FT                   TITKSTSTAFAALPDADPLVAPNDTFPKASLDALTAPIRGVGPATASLILSIATVFGDA
FT                   KKQVPFYSDDVYLWLCLMDFPEGPDVKEQKPSKHKKPNGELIVKYNMHEYRELWNASQA
FT                   LRARLNNAAGENSGDGPVSFIDIERAAYVLRNLAISDYFASQEAEDGSNVVKDVESPND
FT                   SLPKQPEKDSSELGTRRSKRTKKEA"
     atggctaagg aaaccaaaac aaggacactg aatgtccagc ccgagaaaag ccaaggagag        60
     gatgacaaca aacatgtatc attccatccg cgccaaatca ccctcgaaac tttccgcaac       120
     ctgctatacc agtatccttc aacggtagag cgagtgcacc gcagcaagct gatgataaag       180
     ctgcaatcga aggggaaggc aaaggcacca aagcgcaagg cggagacaaa gaccagcgca       240
     gcgccagcca caaaggcaga cctcgatccg tccgaagaga agcatattct cgaagagagc       300
     gatcagttcc tccagcttga ccggtggcgg tacgaagttc tgcccaagct tattgcggag       360
     cgggcgaatg ggagtgcgga gggagcgcac ctggttaagg aggagttaat tgatatcatg       420
     gaatggaaga cgaaacacgg agtctcccgt cccatgctaa tgggaatggt gaaaagcaac       480
     ccagccacaa caatcaccaa gtctacatcc acggctttcg ccgctctccc agatgcggat       540
     cctttggttg ctccgaacga tacattcccc aaagccagtt tagatgccct tactgcacct       600
     atccgtggtg tcggcccggc taccgcatct ctgattttgt ctatcgccac tgtcttcggt       660
     gatgctaaga aacaggtccc gttttacagc gacgatgtgt acctttggct gtgtctaatg       720
     gatttcccag agggtccgga tgttaaagag cagaagcctt ctaaacataa gaagcctaat       780
     ggggagttga ttgtcaagta caatatgcat gagtatcgag agctgtggaa tgcttcgcag       840
     gcgctgcgtg cgcggctgaa caatgccgct ggggagaatt ccggggatgg acctgtctcg       900
     tttatcgaca tcgagagggc tgcttatgtg ctccgcaatc tcgcaatctc ggattacttt       960
     gccagtcaag aagcagagga tggttcaaat gttgtgaaag atgtggagtc gccgaatgac      1020
     tctctgccaa agcaaccaga gaaagattct agtgagcttg gcacgaggcg tagtaagagg      1080
     acaaagaaag aagcatga                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page