(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE292

PENCW_13.PE292       Location/Qualifiers
FT   CDS_pept        join(complement(650830..650845),complement(650708..650784),
FT                   complement(649670..650587))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947676"
FT                   /orf_name="Pc16g02920"
FT                   /product="Putative uncharacterized protein Pc16g02920 "
FT                   /protein_id="CAP92962.1"
FT                   /db_xref="UniParc:UPI0001831BFC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Q0"
FT                   /transl_table=1
FT                   /translation="MSLNQAPISQSGRMLVPVEEKIKTSGDFWNWQRLRAAVFPFLPVN
FT                   IEDTLPLVDEHPTSMQTIESNMGEVIPHHKAVDIPIDSHGNLDEDCTENQDEVNEHELS
FT                   RQVRPAFDTALEENDTKVISNTCCTESPVVSSSESVEGATAKEDLPSPPTSPVPTTTNN
FT                   PTYPIYHNLIPPPPIPLDATTQSRIDKKFQSAIKETPTIRLIVDIPPHLVDWSNPITSI
FT                   TTTINPFLSHWETQNKVNLLAVEIRHGHAYAAIEVNNHNYDFKTAHKQTFVFPVYVLKV
FT                   GRGFRWRFYRAPAVDVSVMNEIKTVHYLHREEVGTPYLVFRVGGREPVSGESRED"
     atgagcctca atcaagcccc tatatcccaa tctggtcgca tgttggttcc tgtcgaagaa        60
     aaaatcaaaa catcaggtga tttctggaat tggcaacgac tccgcgctgc tgttttcccc       120
     ttcctccctg tcaatataga ggatacactc cctctcgtcg atgagcaccc aacatcaatg       180
     cagacaatcg agtctaacat gggagaggtt atcccacacc acaaggcagt tgatatacca       240
     attgacagcc atggcaacct agatgaagat tgcaccgaaa accaagacga ggtgaacgag       300
     cacgagctct cgcggcaggt tcggcctgct tttgatactg ctcttgagga aaatgatacc       360
     aaagtcatca gcaatacgtg ctgcacagag tctcctgtgg tctcttctag cgagtccgtc       420
     gaaggagcca ctgccaaaga agatcttccc agcccaccaa catcaccagt accaacaacc       480
     accaacaacc caacctaccc aatctaccac aacctaatcc caccaccacc cataccacta       540
     gacgccacaa cccaatcccg catcgacaaa aaattccaat cagcaataaa agaaactccc       600
     acaatccgcc taatagtcga catcccgcca catctagtcg actggtcgaa ccccataacc       660
     tccataacga caacaataaa ccccttcctc tcgcactggg aaacgcaaaa caaagtaaac       720
     ctcctagcag tggagatacg gcacggacac gcgtacgcag cgatcgaggt caacaatcac       780
     aattatgatt tcaagaccgc ccataaacag actttcgtat ttccggttta tgtgctgaag       840
     gtggggaggg gttttcggtg gaggttttat cgagctcctg ctgtggatgt gagtgttatg       900
     aatgagatta agacggtgca ttatttgcat agggaggagg tcgggacgcc gtacttggtt       960
     tttagggttg gggggaggga gccggtttct ggggagtcta gggaggacta g               1011
//

If you have problems or comments...

PBIL Back to PBIL home page