(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE293

PENCW_13.PE293       Location/Qualifiers
FT   CDS_pept        complement(651563..653518)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208418" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671653"
FT                   /orf_name="Pc16g02930"
FT                   /product="Pc16g02930 protein"
FT                   /protein_id="CAP92963.1"
FT                   /db_xref="UniParc:UPI0001831BFD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Q1"
FT                   /transl_table=1
FT                   /translation="MLAPNCTGINTLSLPQLKRKRSDSDSDATDAPAPTKVCADSVSTR
FT                   PTPTLIADSVAPTPSTPTTSSNSPVASARPPAQDAVARPSVTRLRETITAQLSLEVLLK
FT                   HNELRLIDQEIAKCQVALEQLRRCGEIPYPGSRVTGVSPDVSLGTGASVLAPGNGPAPM
FT                   SPAPWGVTEGPYARHYARWLLPDPRFDGGEVDSGMPNSLVEGRSTRGNPGEMGMLAGKT
FT                   RPQRGSTATKHTALSSGYPVVKEKSGPMLIRRKSDGVLVKLVCLDCRRDNFSSTQGFIN
FT                   HCRIAHNRNFASHDAAAMACGQSVQVDDAGTVVGGSAEPTANPTTPGYVHPLIRSTHVA
FT                   TTPWKSLRTPAKDSVTPRTPAAATTSAVATPPSTAEPAYRRRSEPIRQPPNPQFLASPA
FT                   TPHLSALMKSRGAGLNMDKLVEESRTPVDLGALFDDDSETDDSRPSGASHTSLGARAGR
FT                   QPMRMPASQTAGESESRKALDRGHSPPTEHATPSRPQSFLDLSLAGQSQSRESNSLDHQ
FT                   ALSPHAIESNQAPSLVSDDEDDYEVASDSDSPASSEEDEQEQEFRHIHVEDDERAAAPS
FT                   ATAEAKPGPSLASPAPQSGPPLSQPLKRSRSKKISSIVPFGDNDDQHVGYIHSPSADNA
FT                   AKAKRAAERKPNQSKR"
     atgctggctc caaactgcac aggtatcaac acactgtcgc tgccccagct caagcgcaaa        60
     cgttcagact ccgactccga cgcgaccgat gcgcccgccc cgacgaaagt ctgcgcggat       120
     tccgtttcga cgcgcccaac tccgaccctg atcgctgatt cggtcgctcc caccccctct       180
     actccaacca cctcgtcaaa ctccccggtc gcgtccgcgc gtccgccggc gcaggacgcc       240
     gtcgccagac ctagtgtgac ccgacttcgg gaaaccatca ccgcccagct gagcttggag       300
     gtgttactca agcacaacga acttcgtctc atcgaccagg agatcgccaa gtgtcaagtc       360
     gctctggaac agctgcgacg ctgtggcgaa atcccttatc ccggatcccg tgttacgggt       420
     gtctcgccgg atgtgagctt gggaacgggc gcgtcagtgc tggcacctgg aaatggtccg       480
     gcgccgatgt cacctgctcc atggggagtg accgaaggcc cgtacgcccg ccactacgcc       540
     cggtggttgc ttcccgaccc tcgctttgac ggtggtgaag tcgactccgg catgccaaat       600
     tcactcgttg agggtcggtc gacgcgtggg aaccccggtg agatgggcat gctggcgggc       660
     aagacacgtc cccagcgagg ctcaactgcc accaagcata ccgcactgtc gtctggttac       720
     cctgtggtca aggagaagtc cgggcccatg ctcatccggc gcaagtcgga tggtgttctg       780
     gtcaagctgg tctgtctgga ctgccggcgc gataacttct ccagcactca gggattcatt       840
     aaccactgtc gtatcgccca caaccgcaac tttgccagcc acgacgccgc tgccatggcc       900
     tgtggtcaat ctgttcaggt cgacgacgcc gggactgtgg tcggtggctc tgccgagccc       960
     actgctaatc ccacaacccc aggctacgtg catcctctga tccgctctac ccacgttgct      1020
     acaactcctt ggaaatctct tcgtacgccc gctaaagact ccgtcacccc ccgcacaccg      1080
     gctgcggcta ccacatctgc tgttgctact cctccctcca ctgctgaacc agcctaccgc      1140
     cgacgatccg agcccatccg acagcctccc aacccacagt ttttggcttc tcctgcaact      1200
     cctcatctgt ctgccctcat gaaatcacgc ggtgctggtc tgaacatgga caagttggtg      1260
     gaagaatcca gaacgcctgt tgatcttggt gctcttttcg acgatgactc ggaaacagat      1320
     gactcccgac catcgggagc cagccatacc tcccttggtg ctcgcgccgg tcgccagccg      1380
     atgcgtatgc ctgctagtca aaccgctgga gagtctgaga gccgaaaggc cctcgaccgc      1440
     ggacacagcc cgcccaccga gcacgcgacc ccgtcgcgcc cccagtcatt tttggacctt      1500
     tcgctcgctg gccagtccca gtctcgggaa tcgaacagct tggatcatca agccctcagc      1560
     cctcacgcta tcgaatccaa ccaagccccc agcttggtca gtgatgatga agatgactat      1620
     gaggtagctt ccgactccga cagtcccgca tcatcggaag aagatgagca ggagcaggag      1680
     ttccgccaca tccacgtcga ggacgacgag cgcgctgctg ccccgtcagc taccgccgaa      1740
     gccaagccgg gaccttccct cgcgagtcct gcgccgcaat ctgggccacc tctgtcgcag      1800
     ccattgaagc gcagtcgctc caagaagatc tcgtctatcg tcccgttcgg tgacaacgat      1860
     gatcagcatg tgggctatat ccattctcct tccgcggaca atgctgccaa ggccaagcgt      1920
     gctgccgagc gcaagcccaa ccagtccaag cggtaa                                1956
//

If you have problems or comments...

PBIL Back to PBIL home page