(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE294

PENCW_13.PE294       Location/Qualifiers
FT   CDS_pept        join(complement(656704..656737),complement(656118..656464))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208407" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947677"
FT                   /orf_name="Pc16g02940"
FT                   /product="Pc16g02940 protein"
FT                   /protein_id="CAP92964.1"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniParc:UPI000004EC06"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Q2"
FT                   /transl_table=1
FT                   /translation="MSSQPLLQTAPGKRIALPTRVEPKVFFANERTFLSWLNFTVILGG
FT                   LAVGLLNFGDRIGRISAALFTIIAMGAMIYALVTFHWRAQSIRRRGQSGIDDRFGPTIL
FT                   AIALLAAVVVNFILRIKDGQMN"
     atgtctagcc aacctctcct ccaaaccgct ccgggcaagc gaattgccct cccaacccga        60
     gtcgaaccca aggtcttctt cgctaacgag cgcaccttcc tctcatggct taacttcacc       120
     gtcatcctgg gcggcctagc ggtcggcctc ctcaatttcg gcgaccgcat cggtcgcatc       180
     tccgcagctc tcttcaccat catcgcgatg ggcgcaatga tctacgcctt ggtgacattc       240
     cactggcgcg cgcagagtat ccgtcggcgc ggacagagcg gtatcgatga ccgattcggt       300
     cctaccatcc tggccattgc cctcctcgcc gccgtcgttg ttaacttcat cttgcggatt       360
     aaggacgggc agatgaacta g                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page