(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE295

PENCW_13.PE295       Location/Qualifiers
FT   CDS_pept        join(complement(659945..660190),complement(659704..659883),
FT                   complement(658631..659639),complement(658147..658571))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000139601" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947678"
FT                   /orf_name="Pc16g02950"
FT                   /product="Pc16g02950 protein"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity, acting on CH-OH group
FT                   of donors"
FT                   /biological_process="alcohol metabolic process "
FT                   /protein_id="CAP92965.1"
FT                   /db_xref="GO:0006066"
FT                   /db_xref="GO:0016614"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="UniParc:UPI0001831BFE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Q3"
FT                   /transl_table=1
FT                   /translation="MAENPTCAIEEFTRTIFDYVICGGGTAGLTLAVRLSENPAVTVGV
FT                   IEAGKYRIGDPLVDTPAAFPQTFENPEYDWCVYSVPQEGNRGVAHHIPRGKLLGGSSGI
FT                   NYMMYVRGSTKDYDNWAELLEDDGWSGEHMQHYMRKHQTLEPIDPSITDRSTMPLVGEF
FT                   HGTSGPIRTGFNDSILPVENDIIKACEDVAGITNKPHDPWSGDHIGFYHTLGAVIRTGP
FT                   NKGKRSYAARGYYEENRATRPNLKVLCEALVNRVVLDGNKATGVSLTHEGVEYQVSARR
FT                   EVIVSGGTIQSPQILELSGIGDPEVLKAAGVECKVANSAVGGNVIDHALSFIVMEVQPG
FT                   IMTLDTLSQVPEAMAAARKQYAETGGGPLTAVSSMQGFFPAKSILSETELAEIIQSIRD
FT                   IKPNSAFHAKQLEQTIANLEDGHSANMQFVTVPGSMNPDAIGHQGNIILPRSADQPAGV
FT                   TLEACLQYPVSRGTIHIESADPTKHPIVNPNYGGHPADISLLAAFLRWCDKVTESEHVK
FT                   SSFLRRAFPDPKVNLQDMDAAREAVHDLVVGEYHISGSVAMGAALDSRLRVKGVEGLRV
FT                   VDASVLSNNVSGNIVSTVYAIAEKAADLIREDWDFSAAKETIA"
     atggccgaaa atccaacctg cgcaatcgaa gagttcaccc gcaccatatt cgactatgtc        60
     atctgcggcg gcggaactgc agggctcact ctcgcagtac gcctcagcga aaaccccgct       120
     gtaaccgtcg gcgtcattga agcaggcaag tatcgcattg gagatccgct ggttgatact       180
     ccagcggcct tcccacagac gttcgagaat ccggagtatg attggtgcgt gtattcggtg       240
     ccacaggaag gaaaccgtgg cgtggctcac catatcccga ggggaaagct cctcggtgga       300
     tccagcggca tcaattatat gatgtacgtg cggggatcga cgaaggatta tgacaactgg       360
     gcggagttgt tagaggatga tgggtggtcc ggggaacata tgcagcacta tatgcgaaaa       420
     catcagaccc tcgagccgat cgacccgtcc atcaccgatc gctccacaat gccacttgta       480
     ggcgagttcc acggcacgag cggacccata cgcaccggct tcaatgattc aatcttgcca       540
     gtggagaacg atatcatcaa agcctgcgag gacgtagccg gcatcacaaa caagccccat       600
     gacccatgga gcggcgacca catcggcttc tatcataccc tcggcgcagt catccgaacc       660
     ggcccgaaca agggcaagcg cagctatgct gcacgaggat actatgaaga gaatcgcgct       720
     actcgcccaa atctcaaagt cctctgcgag gccctcgtca accgcgtcgt actagacggt       780
     aacaaagcca ccggcgtgag ccttacacac gagggagtcg agtaccaagt ctcagcacgg       840
     cgcgaagtaa tcgtcagcgg cgggacaatc caaagccccc agatcctcga gctatcggga       900
     atcggcgacc cggaggtcct caaagccgcc ggcgtcgagt gcaaggttgc caacagcgct       960
     gtcggcggaa acgtcataga ccacgccctc agcttcatcg tgatggaggt ccaacccggc      1020
     atcatgacac tagataccct gtcccaagtg cccgaggcaa tggccgctgc ccgtaaacaa      1080
     tatgccgaaa ctggcggtgg gccactcacc gccgtctcca gcatgcaggg ttttttcccg      1140
     gcaaagtcaa tcctctccga gacagagctg gcagagatca tccagagtat tcgtgatatc      1200
     aagcccaata gcgcgttcca cgcgaaacag ctggaacaga ctatcgcgaa cctcgaggat      1260
     ggccactccg ccaatatgca attcgtcacc gtgccaggtt ccatgaaccc ggacgccata      1320
     ggccatcagg gcaatataat tctaccgcgc tcggctgatc agccggctgg tgtgaccttg      1380
     gaggcttgtc tgcaataccc ggtgtctaga gggactatcc atattgagag tgcagaccca      1440
     accaaacacc ctatcgtcaa tccgaactac ggcggccacc cagcagacat ctccctcctg      1500
     gcggcgttcc tgcgctggtg tgataaagtc acggaatcag aacacgtgaa atcttcattc      1560
     ctacggcgtg cttttccgga tcccaaagtc aacttgcagg acatggatgc ggcccgagaa      1620
     gcggtgcatg acctcgttgt tggtgagtat catatcagcg ggtctgttgc tatgggtgct      1680
     gcgttggata gtagattgag agtgaagggc gttgagggac tgcgtgttgt ggatgcgtcg      1740
     gtgttgtcga ataatgtttc tgggaatatt gtcagtaccg tttacgctat tgcggagaag      1800
     gcggcggatc tgattcggga ggattgggat tttagcgctg cgaaggagac tatcgcgtag      1860
//

If you have problems or comments...

PBIL Back to PBIL home page