(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE296

PENCW_13.PE296       Location/Qualifiers
FT   CDS_pept        complement(661257..662447)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216713" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671654"
FT                   /orf_name="Pc16g02960"
FT                   /product="Pc16g02960 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP92966.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001831CD2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Q4"
FT                   /transl_table=1
FT                   /translation="MPPLRAHTKSRNGCDQCRIRRVKCDEKGPPCSNCTTRELKCTYLK
FT                   VAARRAATHITPPSSTSDVLQSLDGHGSPVAAMPGPAVATIPVSAPTQTNSFGINNLEL
FT                   MHKFATETYKSLCISDSEMQIWKITVPTLALKHDYLMNGILALASLHIATTCGPSEVAL
FT                   MYYEAGLQYYNRSLTPFRNAIDSITPHNCDAVFAHSIVMIAIGIASPQLTGMKDECAST
FT                   TKNIVILFELLQGVKKILQVSKSWIKLELFSQGEFWKNTPAELDPDTEAALTHLSDLND
FT                   RVMVGVYSEQHRINKTVIAHLRHCYAKFAHSADPAPAFAWLAAVEKGFVDSLRCRQPFS
FT                   LLILMYWGVLLRELDGLRWWARDAGRVLVSELFDALRSGDPRWQSALGWVQRKMGL"
     atgcctcctc ttcgcgcaca taccaaatcc cgcaacgggt gcgatcaatg cagaatcagg        60
     cgggtcaaat gtgacgagaa gggcccacca tgttcgaact gcacaacccg cgagttaaaa       120
     tgcacttatt tgaaagtcgc cgcccgtcgc gctgcaaccc atattacccc acccagctca       180
     acatccgacg tactgcagtc tctagatggc catggctcgc ccgtggcagc gatgcccggt       240
     ccagccgttg caacaatccc ggtctcggca ccgacccaaa caaactcatt cggcatcaac       300
     aacctagaac taatgcataa gtttgcaaca gagacataca aaagcctctg catcagcgat       360
     tcagaaatgc aaatttggaa aataaccgtc ccgacactcg ccttgaaaca tgactacctg       420
     atgaacggga tcttggcgct agcctcactg cacatcgcaa caacctgcgg gccatcagaa       480
     gtagcactca tgtactacga agctgggcta cagtactaca accgcagcct gacgccattc       540
     cgcaacgcga tcgatagtat cacgccgcac aactgcgacg cggtattcgc gcactcgatt       600
     gtcatgatcg cgatcggtat cgcgtcgccc caactaacgg gaatgaaaga tgagtgcgcc       660
     agtaccacaa agaacatcgt gatactattc gagctgctgc agggtgttaa gaagatcctg       720
     caagtcagca agtcctggat taagctagag ttattctcgc agggggagtt ttggaagaac       780
     acgcctgccg agctcgatcc ggatacggag gctgcgctga cgcatctgtc ggacttgaat       840
     gatcgggtta tggtaggggt ctactcggag cagcatcgca ttaataaaac tgttattgct       900
     catctgaggc attgttatgc caagtttgca cactcggcag atccggcgcc ggcttttgct       960
     tggcttgcgg cggtcgagaa gggctttgtg gatagtctcc ggtgtcggca gccgttttcg      1020
     ttgttaattc ttatgtattg gggagtgctg ttgagggagc ttgatgggct gcggtggtgg      1080
     gcgcgggatg cgggtagagt gctagtctcg gagttgtttg atgctttgag gtcaggggat      1140
     ccgaggtggc agagtgctct cggttgggtg cagaggaaga tggggctttg a               1191
//

If you have problems or comments...

PBIL Back to PBIL home page