(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE299

PENCW_13.PE299       Location/Qualifiers
FT   CDS_pept        join(complement(671280..671576),complement(670983..671226),
FT                   complement(670809..670927),complement(669863..670756))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000158948" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128684"
FT                   /orf_name="Pc16g02990"
FT                   /product="Pc16g02990 protein"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP92969.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI0001831CD4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7L3"
FT                   /transl_table=1
FT                   /translation="MNTLLELTTKLALFVAILLTSRFLWNYLRSPLKSFPGPNLASFTN
FT                   IWRMQDVAKGRCDVTHNNLHRRYGSAVRMGPNVLSLSDPDLISVVYNTKNPWLKSDMYN
FT                   VNDVVVSGVRLKNLFSNQNESWHSTYIRPVKNLYSMSKVQDAESNIDITIKLLCEKLRA
FT                   RFVRPGKTCEMSDWISFFAWDTMSQVTFSKDLGILEAGSDYKGFLRRSNQTLDYFAAIC
FT                   QIPLLDYLFDKNPIMRIGPPTFLWANIFSLEQLHRRYQEGNHDGDFLSKFLELKQRNPE
FT                   LVNDNTVILWLLSNVLAGSDSTAGTMCATIYYVLRDPGVCQRLCDELRGANLSSPAQWK
FT                   EIKALKYLEAVMRESMRINPGVGLMLERIVPKGGLTLPDGRFVPEGTTVGMNPWVINRN
FT                   ETVFGAKTHEFIPERWLQNPGETEEAYQARFSKMKSTDFTFGAGSRACLGRYLSQLESF
FT                   KLIATLFNTFDVSLNCILRFRVNGILANWLHRWRSPVATMSGSSRIRGSLGRKAFLSTW
FT                   "
     atgaataccc ttctagaact tacaaccaag ctcgccctat ttgtggcaat tctcctcacc        60
     tctcgtttcc tatggaatta tcttcgatcc cctctgaagt ctttccccgg tcctaatctg       120
     gcgagcttca caaacatatg gcgcatgcaa gatgtagcca aaggccgttg tgatgttaca       180
     cataacaacc tgcaccgcag atacgggtct gctgttcgta tgggtccgaa tgtcctcagt       240
     ctctccgatc cagacttgat cagcgttgtt tataatacca agaatccgtg gcttaagagc       300
     gacatgtaca atgtcaacga cgttgtcgtc agtggtgttc gattgaaaaa tctgttctcg       360
     aatcagaatg agagttggca ctcgacttac atccgcccag tcaagaactt atattctatg       420
     agcaaggttc aagatgccga gagcaatata gacattacta tcaagctcct ttgtgagaag       480
     ctccgagcgc ggtttgtccg cccgggtaag acttgcgaga tgtctgattg gatcagcttc       540
     tttgcatggg atactatgag ccaagtcacg ttctcgaaag atcttggtat tctggaagct       600
     ggcagtgact acaagggatt ccttagaagg tcaaaccaga cgctcgacta ctttgctgca       660
     atctgccaaa tccctctcct ggactatcta tttgacaaaa acccgatcat gcgcattggg       720
     ccgcccactt ttctctgggc caatatcttc agtcttgaac aactccacag acgctatcaa       780
     gaaggcaacc acgacggcga tttcctttcc aagttcctcg aacttaagca gaggaaccca       840
     gaacttgtca atgacaacac tgtgattctc tggctactct ccaatgtgct tgcaggtagc       900
     gactcgacag cagggaccat gtgcgcgacc atttactacg tcctgaggga ccccggcgtg       960
     tgccagaggc tttgcgacga actccgcggt gctaatctct cctctcccgc tcaatggaaa      1020
     gaaattaaag cactgaaata tcttgaagcg gttatgcggg aatcaatgcg cattaatccc      1080
     ggagtcggcc ttatgctcga gcgtattgtt cctaaaggtg gtctcactct accggacgga      1140
     cgcttcgtgc ctgaggggac taccgtgggc atgaacccat gggtgatcaa taggaacgag      1200
     acagtcttcg gtgccaagac acatgaattt atcccggagc gttggcttca gaatccaggg      1260
     gagacggaag aggcatacca ggcgcgcttt tctaagatga aaagcaccga tttcacattc      1320
     ggcgctgggt cgcgtgcctg cttgggacgc tatctctcgc agctggaaag cttcaagcta      1380
     atcgcgacac ttttcaacac attcgacgta agtttgaatt gtatcctcag atttcgggtc      1440
     aacggcatat tggctaactg gctacacaga tggcgctccc cagtcgcgac catgagtggc      1500
     agctcacgaa ttcgtggttc attaggcaga aaagcattcc tgtctacctg gtag            1554
//

If you have problems or comments...

PBIL Back to PBIL home page