(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE30

PENCW_13.PE30        Location/Qualifiers
FT   CDS_pept        complement(67094..68347)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076647" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823845"
FT                   /orf_name="Pc16g00300"
FT                   /product="Pc16g00300 protein"
FT                   /function="metal ion transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP92700.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0046873"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniParc:UPI0001831E8F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6T7"
FT                   /transl_table=1
FT                   /translation="MYPRTIKITLSLPRGRLSICTNAQHQFHRLSGTLRMTQPMQSIPS
FT                   CGRRGIVTLPNKSHHVIQEPDMKKEASFNQNVFNLSLALSKSRINDATELRCMVLGLDG
FT                   SVKESDIRGTRDGLAKEWGLDGRDLRNVDLVSEGIPHLLVRPSVIFISMFTLRLLVRAH
FT                   GVLLFLLPIEDCHVKVQDVFMTDLQRRLHPGSGSGLLAKLPFELRVVDAALASVIATLE
FT                   AEHVLIRREVQDSLQDSTREDVVYAVLRDLQDHRKRLVAIQQRASQFRSALREILENDE
FT                   DMATMFLTDRQAGRPHEVEDHLEVEYLLEAYYKNTDAIAESANALLGDLERTVETIHSV
FT                   LDVRRNQIMVFEAQLEICMLGFAVPTFVAGLFGMNVANFFEESTSAFVVLVAVCVMGTV
FT                   TIAKYGLWKLDKFRKLRF"
     atgtatccac gtactatcaa gatcacttta tccttgccga gagggagact gtcaatatgt        60
     acaaatgcac agcaccaatt ccatcgcctt tccggtactc tccgcatgac acagcccatg       120
     cagagcatcc ccagctgcgg cagacgggga atcgtcaccc tccccaataa atcacatcat       180
     gtcatacagg agcctgacat gaaaaaagaa gcttccttca atcaaaatgt gttcaacttg       240
     tctcttgctc tgtcgaaaag ccgcataaat gatgcaacag agttacgctg catggtcttg       300
     ggtctggatg gctctgtcaa agaatcagac attcgaggaa ctagggatgg gctcgctaaa       360
     gagtgggggt tagatggccg cgatttgcgc aacgtggatc ttgtctcgga gggaattccg       420
     catttgttgg tgcgtccatc ggtcatcttt atcagcatgt tcactttacg gctcctggtc       480
     cgcgcacatg gagtgcttct gttcctcctc ccgatcgagg actgccacgt gaaggtgcag       540
     gatgtcttca tgacggacct ccagagaagg ctccatcccg gttctggctc tggtctctta       600
     gcaaaactcc cttttgagct acgggtggtg gatgcagcgc ttgcctctgt tatcgcaact       660
     cttgaagccg agcatgttct catccgccga gaagtccagg acagcttgca ggattcaacg       720
     agggaagatg tcgtttacgc tgttctccgc gacttgcagg atcaccggaa aaggcttgtg       780
     gccatccagc agcgtgccag ccagttccgc tcggcgctac gggaaatcct tgaaaatgat       840
     gaagacatgg cgaccatgtt cttgacggat cggcaggcag gtcgaccgca tgaggtagag       900
     gatcacctag aagtggaata tctcctcgag gcatattaca agaacacaga cgcgatcgcg       960
     gagtctgcca atgctttact gggtgacttg gagcgcacag tagagaccat tcactcggtt      1020
     ttggatgtgc gacgaaatca gatcatggtt ttcgaggctc aactggagat ctgtatgttg      1080
     ggattcgccg tgccaacttt cgtggccggg ctgtttggga tgaacgtggc gaacttcttt      1140
     gaagagagta cttccgcatt tgtggtcctt gttgcagtgt gcgtgatggg aacggtcacc      1200
     atcgcgaagt atggcctatg gaaactcgac aagttccgga aattgcggtt ctaa            1254
//

If you have problems or comments...

PBIL Back to PBIL home page