(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE300

PENCW_13.PE300       Location/Qualifiers
FT   CDS_pept        join(672254..672470,672527..672545,672615..673344)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947680"
FT                   /orf_name="Pc16g03000"
FT                   /product="Pc16g03000 protein"
FT                   /protein_id="CAP92970.1"
FT                   /db_xref="UniParc:UPI0001831CD5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7L4"
FT                   /transl_table=1
FT                   /translation="MFLLLYDLVACLYNVVSTLKVPKACGCFGSLLSCLSTALLFHSHL
FT                   SEIPLPRLHYHIPTSPFFVHFLIHASHAASGTAPGYRSNQARDTHHTTRQNSQPPTIAF
FT                   VNSESRQVVLERGRILESVEGNDLKWLWVQPRRDTLHLIGRKCYTLFRGLMMTPRVQLS
FT                   NSYCMRCILGSATDAVVAYSMPVLQLAEAIDSMKRIKKIGQNAIDVHRKELITEILAIV
FT                   LMVIPFAGKALGPLICSATPMARIALLVGEMGNGGLVVAALSAILGLIAGIDSGTGKLS
FT                   KGEALVEASNARGLLKASDLAKSPEGFRNFDQPLGCSQIS"
     atgttcttat tgttgtatga tcttgtcgcc tgcctatata acgtcgtgtc gacactgaaa        60
     gtgcctaagg cttgcggctg ttttggctct ctcctctcct gcctctcaac cgctcttctc       120
     ttccatagtc atctatctga gatcccctta ccgcgacttc actatcatat ccccacctct       180
     cctttctttg tccacttttt gatacacgca tcccatgctg cctctggaac tgcgcccggc       240
     tacagatcaa atcaagcccg cgatactcat cacacgacgc gacaaaattc tcagccgccg       300
     accatcgcgt tcgtcaatag cgagtctcgg caagtcgtgc tggaacgggg acgcatattg       360
     gaatccgttg agggcaatga cctgaagtgg ctatgggtgc aaccgcgccg ggatacactg       420
     cacttaattg gacgcaaatg ctatacgcta ttcagggggt tgatgatgac gccacgggtc       480
     caactgtcga attcctattg catgcgatgt attttgggat cggccaccga cgccgtagtc       540
     gcctactcca tgccggtatt gcaactcgcc gaagccatcg acagcatgaa gaggatcaaa       600
     aagatcggcc aaaatgccat agatgtccac aggaaggaac tcatcacgga gatcctcgcc       660
     atagtcctta tggtcattcc ctttgctggc aaggctctcg gccccttgat ctgcagtgca       720
     acgccaatgg ctcgcattgc gcttctggtc ggcgaaatgg gcaacggagg gctggtagtg       780
     gctgcgctgt ccgccatact gggtctgatt gcgggtattg acagcggcac cggcaagctg       840
     tctaaggggg aggccctggt agaagcttct aatgcgaggg gcctattgaa ggcgagcgat       900
     ttggccaagt cccctgaggg ctttaggaac ttcgaccagc cattaggttg ctcccaaatc       960
     agctag                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page