(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE301

PENCW_13.PE301       Location/Qualifiers
FT   CDS_pept        join(complement(675401..675610),complement(674845..675327),
FT                   complement(673857..674789))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000161934" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947681"
FT                   /orf_name="Pc16g03010"
FT                   /product="Pc16g03010 protein"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAP92971.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016168"
FT                   /db_xref="UniParc:UPI0001831CD6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7L5"
FT                   /transl_table=1
FT                   /translation="MHISSLIGGLSAIGGLTLAQAAVDSPVIEADDFSITGALEDLGVD
FT                   VSQIPALKSFAAIETRSTDKACAVACASLSFLFGSKVSAQETTGYNNFTSSFWSVQQEE
FT                   VQPHCVFRPTKNTEVSTAVLLSRLTGCEFAARSGGHAAFTGASSAPGGISIWFKDMSAV
FT                   TLNADKTVASIEPGNNWLTTYAALEPYGLAVIGGRASSIGVGGFVLGGGISYHSNLYGW
FT                   SCDNVESFEVVTASGLIVTASATSYPDLYWALRGGGNNFGLVTKYNMFTIPSPEMYGGA
FT                   RTFLETEFPQVINAWINVINNATVDGNAQQYVAFLQTQGMNLASAELTYVKNDPNPEIF
FT                   KQYRNISAISDNSSAKSLVEYVKYLETENPYGLREVYWPISAALDEKFANWVVNLFYSM
FT                   IPEVGNVAGAQPVLIYQGITEPMLNNMKNHSGNPLGLAGSSGPVHLLHISCWWKNESDD
FT                   KTVYAFVNKFMEKVTTEAKNVGVFNEYVYMNYASMFQDAVAGYGAANKAQLKKIAKKYD
FT                   PREVYQNLQPGYFKLDGPPVTPSF"
     atgcatattt catccctcat tggcgggtta tccgcgattg gcggactgac gctggcccag        60
     gccgccgtcg acagcccagt tattgaagct gacgatttca gcatcactgg cgcattggag       120
     gatctcggtg tggatgtgtc gcaaattccg gcattgaagt cgttcgctgc cattgagaca       180
     cggtcaaccg ataaagcctg tgcagttgct tgtgcaagtt tgagcttcct ttttggctcc       240
     aaagtctctg ctcaggagac cactgggtac aacaacttca ctagctcgtt ctggtctgtg       300
     cagcaagaag aggtgcagcc tcattgcgtt ttccgtccta ccaagaacac ggaagtcagt       360
     actgcagttt tgctttcccg tttgactggt tgcgagtttg ctgctcgcag tggcggtcat       420
     gctgccttta ccggtgcttc tagcgcccct ggcggaatca gcatctggtt caaggatatg       480
     agcgccgtca cccttaacgc agacaagaca gtcgcgtcta ttgaacctgg aaacaattgg       540
     ctcactacct atgctgccct cgagccctat ggcttggctg ttatcggagg tcgtgcttct       600
     agcattggtg ttggtggttt cgttttgggt ggtggaatct cctaccactc caacctgtac       660
     gggtggtctt gtgacaatgt tgagagcttc gaggtcgtta ccgctagcgg tctgattgtg       720
     actgcgagcg ccacttccta ccctgaccta tactgggctc tccgcggtgg tggcaacaac       780
     tttggtcttg tcaccaagta caatatgttc acaatcccct ccccagagat gtatggcggt       840
     gctaggacct tcctcgagac cgaatttccc caggttatta acgcttggat caacgtgatc       900
     aataatgcca ccgttgacgg caatgcccag caatatgtcg cctttcttca gacccaagga       960
     atgaaccttg cctccgccga actgacctat gtcaagaacg acccaaaccc tgaaatcttc      1020
     aagcaataca gaaacatttc ggctatttcc gacaattcca gtgccaagtc ccttgttgag      1080
     tacgtcaagt acctcgagac cgagaaccca tacggccttc gcgaggtgta ttggcccatc      1140
     agcgcggctc ttgacgagaa attcgctaac tgggtggtga atctcttcta ctcgatgatt      1200
     cccgaggtgg gcaatgttgc cggtgcccag cccgtcctca tctatcaggg catcaccgag      1260
     cccatgttga acaacatgaa aaaccacagt ggcaaccctc tcggactcgc cggttcctct      1320
     ggccctgttc accttctgca catctcctgc tggtggaaga acgagtctga tgacaagact      1380
     gtctacgcgt tcgtcaacaa gttcatggag aaggtaacta ctgaggccaa gaacgtcggc      1440
     gtcttcaatg aatatgtcta tatgaactac gccagcatgt tccaggatgc tgtcgctgga      1500
     tatggcgctg ctaacaaggc ccagctgaag aagattgcca agaagtacga ccccagggag      1560
     gtttatcaga atctccagcc tggttacttc aagcttgatg gtcctcccgt gactccatct      1620
     ttctag                                                                 1626
//

If you have problems or comments...

PBIL Back to PBIL home page