(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE302

PENCW_13.PE302       Location/Qualifiers
FT   CDS_pept        join(676784..677204,677336..677422,677476..677673,
FT                   677741..678090)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201315" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128685"
FT                   /orf_name="Pc16g03020"
FT                   /product="Pc16g03020 protein"
FT                   /protein_id="CAP92972.1"
FT                   /db_xref="UniParc:UPI0001831CD7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7L6"
FT                   /transl_table=1
FT                   /translation="MGEAIAGTFGTGTIKGTGISLIVLTSLVVGTRFAGLIRSFKDLKA
FT                   EDYLLIVAYIFFLELSILYIYIAPAIFRIAAVSAGTIPPYATISEYGLRLQTVFFVTTS
FT                   SLWLCLWMVKFSLMAMYKRLLVGKKYIIAWWVIMGFCQCDTPRDHRAAVISLYYAYGVD
FT                   IATDLAIMILPIRLIWNLQMKTRQKLSIGGLFCFGWICIIVSTIRVVQLGETENGVPAP
FT                   SWLALWGTIEALIAVMIGCCPGLYRVLKNAISPSKTSYPYDSYNLRGRGGSGMPSNRSG
FT                   AFGRTDIPLNSFRGKEESYQSASAYRSTSPSSSQEKLADLDDRRNIMVNYGVAVTVENR
FT                   PRDYGQATRFV"
     atgggagagg ctattgccgg cacatttggg accggtacca ttaaaggtac tggcatttcc        60
     ttgattgtac tcacctcgct ggttgtcggt actcgttttg ctggtcttat tcgaagcttc       120
     aaggacttga aggctgaaga ctaccttctg attgtcgctt acatattctt cttggagctg       180
     agcattctct acatctatat tgccccggct atctttcgaa tagcagcagt cagtgccgga       240
     acgattcccc cctatgccac catttcggaa tatggactcc ggttacagac tgtcttcttc       300
     gtcacgacat cttcgttatg gctttgcttg tggatggtga agttctcgct tatggcgatg       360
     tataaaaggc tgttggtcgg gaaaaaatac ataatcgcct ggtgggttat catggggttt       420
     tgccaatgcg acacaccgcg cgaccatcgg gcggctgtta tcagcttata ctacgcatac       480
     ggggtggata tagccactga cttagcaatc atgatccttc ccatccgcct catctggaac       540
     ctacagatga aaacgcgcca gaagctgagc attggcgggt tattctgctt tggctggatc       600
     tgcataattg tttccaccat ccgagtcgtt cagctaggtg agactgagaa cggagtcccc       660
     gccccatcat ggctagcgct atggggaacc atcgaggcct taatcgctgt catgatcggt       720
     tgttgccccg gcctctatcg cgtcctcaaa aatgctatct cgccctccaa gacgtcctat       780
     ccgtatgact cgtacaactt gcggggccgt ggaggcagtg gtatgccatc gaaccgctcc       840
     ggtgcatttg gaagaaccga tattccgttg aatagtttta gaggaaagga ggagtcgtac       900
     cagtcggcga gtgcctaccg ttctaccagt ccgtcaagca gtcaggagaa actggccgat       960
     cttgatgaca ggaggaatat aatggtgaac tatggagttg ctgtgacggt agagaatcgg      1020
     ccgagagatt atggccaggc gacacggttt gtgtaa                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page