(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE306

PENCW_13.PE306       Location/Qualifiers
FT   CDS_pept        join(685322..685426,685481..686066,686122..686372)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671655"
FT                   /orf_name="Pc16g03060"
FT                   /product="Pc16g03060 protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP92976.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001831CDA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7L9"
FT                   /transl_table=1
FT                   /translation="MVKVAVAGGTGGVGRTIVEELLRQDKHNVIILSRKSTPLPGLPSV
FT                   PVSAIDYDDIASVATFLREHSVDVVISTLSLFTEEVGKAQMNLIQAAIESSAVNRFIPS
FT                   EFAFNYSHPGLLDFHAAAQMRIDAADLLRSSHVDFTRFVFGWMLDTWNPVRAKSHMPPM
FT                   SWVLGFENRRARIPGDGKAPLTFLHSFDLAKFVAALLDEENRWPETSAFAGDRITFNEV
FT                   VELAESIMGQKWEVTYEPVSRLEKKDVVVFEQPEGSYDFGEGLRDVTAEFGLIVVKDMM
FT                   DASVDGLRNMDFPNVRPITVEAWMHQIWGKKA"
     atggtcaagg tagcagtcgc aggaggtacc ggtggcgttg gccgaacgat agtcgaagaa        60
     ttgcttcgac aagataagca caatgtgatt attttgagta gaaagtctac tccactaccg       120
     ggcttgccgt ctgttccggt gtctgcaatc gactacgacg acatcgcgtc tgtcgcgacg       180
     ttcctacgag agcacagcgt cgatgtcgtc atatcaaccc tatccctctt tacggaagaa       240
     gtagggaaag cacaaatgaa ccttatacag gcagcaatcg aatctagtgc agtcaaccgt       300
     tttataccta gcgaatttgc cttcaactac tcgcaccctg ggcttctcga ttttcatgct       360
     gcagctcaga tgcggattga tgccgctgac cttttgcgca gctcgcatgt cgatttcacg       420
     cgcttcgtct ttggctggat gttagacacc tggaaccctg tgcgcgctaa gtctcatatg       480
     ccgccgatgt catgggtcct tggtttcgag aatcgacgag cgaggattcc cggagacgga       540
     aaggcgccgc ttacgtttct acactcattt gacttagcga aattcgtcgc tgcgctactt       600
     gatgaagaaa acaggtggcc ggaaacaagt gctttcgctg gagataggat tacattcaat       660
     gaagtggttg agctggcgga gagcatcatg ggtcagaagt gggaggtcac atatgagcct       720
     gttagtcgac tagagaagaa agacgtcgtt gtgtttgagc agccggaagg ctcatacgat       780
     ttcggggagg ggcttcgaga cgtgacggct gagtttggtc ttatagtggt taaagacatg       840
     atggatgcga gcgtagacgg cttacggaac atggacttcc caaatgtcag gccaatcact       900
     gttgaggcat ggatgcacca gatatgggga aagaaggctt aa                          942
//

If you have problems or comments...

PBIL Back to PBIL home page