(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE307

PENCW_13.PE307       Location/Qualifiers
FT   CDS_pept        join(687451..687653,687717..687923,687994..688098,
FT                   688187..688275,688305..688341,688371..689454)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977567"
FT                   /orf_name="Pc16g03070"
FT                   /product="Pc16g03070 protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP92977.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="UniParc:UPI0001831CDB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7M0"
FT                   /transl_table=1
FT                   /translation="MDDRELVSILHPGLGAVFKGVKTAEFLDQKSSSVAQFRGIKFARI
FT                   PTRFRRAILHENFPPIVDATNHGPICPQSIGQRKFEDLLNGASPESLAVAGQLESPVMD
FT                   EFECLNLVITAPVLKSTESVAEELFPVMIYIHGGGNFVGANSFWFNDGRHLVKKGMESN
FT                   LPTVIVALNYRLSALGWLSSQTLREYNAAFGDVGVGNYDDANKSTQAAMMFADKIHKHL
FT                   GIEWVYRNISGFGGDPNNITIFGESAGGFAVDNQIHSQLPCRFSQAILQSGVMSSHMSS
FT                   PLPLSDQDTLFDLVKARAHVNTVEELRDIPVDVLLQAFAKASSETGFSAVPTIDDEMFT
FT                   QSWAEHYSFANEDFRVIIGHTTYERSLFEILAHLHSEAKDNDQSFERICSSFLAHIEGM
FT                   EATELCEAYGYQDDIQPARLKQCLMKILEDIVFVTPINEATTRYIQKGLAVYRYIFDEP
FT                   NPFKGAFSGKSNHALDLPYLFGSASIFAGVENKDWEQDIQDSLQTKWLLFAHGIPPWPS
FT                   VSDGKFLVFGPHGTVNEHSSTELISKSLSISDDIFGSLELGYRAELSMLVWKHARLL"
     atggatgacc gtgaacttgt ttccatactt catcctggtc taggtgccgt attcaaaggt        60
     gttaagactg ctgagttttt ggaccagaaa tccagctcag ttgcccaatt tcgtggaatc       120
     aagtttgctc ggatccctac gcgcttccgg cgtgctattc tccacgaaaa tttcccaccg       180
     attgttgacg caaccaatca tggtcccata tgccctcaaa gcattggcca gaggaaattt       240
     gaagatcttc tcaatggtgc ctcgcccgag tcgctcgcgg tggctgggca actggaaagc       300
     ccagtaatgg atgagtttga atgcttgaac ttggtgatca ctgccccagt tttgaaaagc       360
     actgagagtg tggctgagga actatttcca gtgatgattt atatccatgg tggaggtaac       420
     ttcgtgggag ccaattcttt ttggtttaat gacggaagac atctcgtcaa gaagggcatg       480
     gaatcaaatc tgcctacggt aatcgtcgcc ttgaattacc gtctctctgc gttaggatgg       540
     ctctcttcac aaacgctccg agaatataat gccgcgtttg gtgacgtcgg tgtcgggaat       600
     tacgacgatg ctaataagtc gactcaggct gccatgatgt ttgctgacaa aatacataag       660
     catctcggca ttgagtgggt gtataggaac atcagtggct ttggcggtga tccaaacaat       720
     atcactatat ttggagaatc cgcaggagga ttcgcggtag acaatcaaat ccattcccag       780
     ctcccgtgca ggttttcaca ggccattttg cagtctgggg tgatgagctc ccacatgtct       840
     tccccgctgc cgctttctga tcaagataca ctatttgatc tggttaaagc ccgcgctcat       900
     gtcaataccg ttgaggaact acgagatatc cccgttgatg ttttactaca agcctttgca       960
     aaggcgtcct cggaaacggg gttctctgca gttcctacta ttgacgatga gatgtttacg      1020
     cagtcatggg cggagcacta tagctttgct aacgaggact ttcgagttat aattggccac      1080
     acaacctacg agcgctcctt gttcgagatc cttgcgcacc tccactccga agccaaagac      1140
     aacgatcaat cgtttgagag aatttgctcg tcgttcttag cacatatcga aggaatggag      1200
     gccacagaac tctgcgaggc ttacggatat caggatgaca tacaaccagc tcgtctgaag      1260
     caatgtctga tgaagatcct ggaagacatt gttttcgtta caccaataaa tgaagcgact      1320
     acgcgctata ttcaaaaggg gctagccgtc tatcgatata tcttcgatga gccaaatcct      1380
     ttcaagggtg ccttctccgg aaagtctaac cacgctcttg accttcccta tttgtttgga      1440
     agtgcgagta tctttgctgg tgtggagaac aaggactggg agcaggatat ccaagacagc      1500
     ttacagacga agtggctact ctttgcacat ggtatcccgc catggccgtc agtgtctgat      1560
     gggaagttct tggtatttgg acctcatggg acggtaaatg agcattctag tacggaactt      1620
     atcagcaagt cgctgtctat ctcggacgat atctttggtt ctttggaatt gggataccga      1680
     gccgagttat caatgttggt ttggaaacat gctcgactgc tatga                      1725
//

If you have problems or comments...

PBIL Back to PBIL home page