(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE308

PENCW_13.PE308       Location/Qualifiers
FT   CDS_pept        join(complement(692440..692618),complement(691966..692300),
FT                   complement(691609..691910),complement(691391..691556),
FT                   complement(691141..691331))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158981" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128686"
FT                   /orf_name="Pc16g03080"
FT                   /product="Pc16g03080 protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP92978.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001831CDC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8X0"
FT                   /transl_table=1
FT                   /translation="MLTSFLQSLPRLGRRWTPLNFTNPNFIQLSASQAIEEETIPGYIA
FT                   GRYYPTRIGEILKDRYRRYVTLKIFIKSTSMGQQLDDELKIYKRIEGAPQKHPGRKYVR
FT                   SLLDSFDISGPEDKHRCLVHPPLWESMLDFLFRNPVQRLPTPILAVTLHRLFLALDYLH
FT                   TECKIIHTDIKADNIMFGIADDSVLSDFENTELQHPCPRKELDGRTIYTSRELRMPKNL
FT                   GAPILCDFGSAVIGDKEHSEDIQPDIYRAPEVILQAPWSYSVDIWNVGCVIWNLFEGGS
FT                   LFSGQDPEFQTYRSRAHLAEMIRLLGPPSPSFLARGNLTQRFFSQEGDLYAGELVGEHI
FT                   PLEQRETSLEGEEKEMFLRLMRKMLQWEPEKRSSAMELEQDEWVQAELHK"
     atgttgacgt cttttcttca gtccttgccc cggctcggac gaagatggac acctctcaac        60
     ttcaccaatc cgaatttcat tcaactatca gcgagccagg caatcgagga ggaaaccatt       120
     ccgggctata ttgcgggtcg gtattatcct actcgaatag gggaaatact caaggaccgc       180
     tatcgtcgat atgtcactct caagattttc ataaagtcca catcgatggg gcagcaacta       240
     gacgacgagc tgaagatata caaacgtatc gaaggggctc cccagaagca tccaggtcgt       300
     aaatacgtca gatctttgct agactccttt gacattagcg ggcctgaaga caaacatcga       360
     tgtctcgtgc atcctccatt gtgggagagt atgttggatt ttctattccg caacccggta       420
     cagagactac caacaccaat cttggcagtg acacttcatc gtctattcct tgcattagac       480
     tatctacata cagagtgcaa gattatccat actgatatca aagcagataa catcatgttc       540
     ggtatcgctg atgattcggt tctcagtgac tttgaaaata ctgagctgca acacccctgt       600
     cctaggaagg aattagatgg acgaaccata tatacctccc gcgagctcag aatgcctaaa       660
     aacttaggcg cgcccatcct ctgcgatttt ggctcagccg tgataggtga caaagagcac       720
     tcggaagaca ttcagccgga tatctatcga gcaccggaag tgatcttaca agctccatgg       780
     tcatatagtg ttgatatatg gaacgtggga tgcgtgattt ggaacctttt cgaagggggg       840
     tcgctgttta gcggccagga cccagagttt cagacctaca gaagtcgggc acatcttgcc       900
     gaaatgatac gactactcgg tccgccatcg ccaagtttcc ttgcccgggg gaatctgacc       960
     caaaggtttt tttcacagga aggtgacttg tacgccgggg aattggtggg agaacacatc      1020
     ccgctcgagc aaagagagac tagtctcgag ggagaggaaa aagaaatgtt tctccgccta      1080
     atgcgaaaaa tgctacaatg ggagccagaa aagcgaagct ctgctatgga acttgaacag      1140
     gatgagtggg tgcaagcaga attacataaa tga                                   1173
//

If you have problems or comments...

PBIL Back to PBIL home page