(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE309

PENCW_13.PE309       Location/Qualifiers
FT   CDS_pept        join(696176..696248,696299..698309,698371..698773)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000031215" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128687"
FT                   /orf_name="Pc16g03090"
FT                   /product="Pc16g03090 protein"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP92979.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR011658"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0001831CDD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8X1"
FT                   /transl_table=1
FT                   /translation="MPQTFDVEHVLANISEQDKIALLSGIDFWHTHPIPEFNVPSIRAT
FT                   DGPNGIRGTKFFAGIPAACLPCGTALGATWDRDLIYQAGELLGDECIAKGAHCWLGPTI
FT                   NMQRAPLGGRGFESFAEDPHLSGILAKSIILGCESKGVISTVKHFVGNDQEHERRAVDV
FT                   LVTQRALREIYLRPFQIVARDAKPGALMTSYNKINGKHVVEDERMLNLIREEWKWNPLV
FT                   MSDWYGTYTTIDSMNAGLDLEMPGVSRYRGKFIESAVQARLIKQSTVDARARKVLEFVK
FT                   QASQVQVSEVERGRDLPEDRALNRKLCANSIVLLKNEGILPLPREIKKIALIGSHMKCP
FT                   AISGGGSASLEPYYSVSLYDACREALPDAEVLYQVGAYAHKMLPVIDRLLSNAIIQFYN
FT                   EPMCKERHLISTEPVSTTAFQFMDYYAPGLNRALFWATLIGDFTPDTSGIWDFGLSVFG
FT                   TANLYIDDELVIDNTTSQTRGTAFFGKGTVEVLGSKELVAGTIYKVRIEFGSANTTTMK
FT                   TVGMVNFGGGAASLGACLRMNREEMIENAVEAATEADYTILCTGLNKDWESEGFDRMHM
FT                   DLPPGVDELISKVLKAAADKTVIVNQSGTPVTMPWADQARCIVQGWYGGNETGHGIADV
FT                   LFGEVNPCAKLPLSWPVDVKHNPAYLNYASVGGRVLYGEDIYGGYRFYEKTGREVLFPF
FT                   GHGLSYTTFNVSPNVTVAPEIFNMDVPTVATVQIKNTGKLAGAQILQLYISAPESSTPR
FT                   PSKELHGFEKVFVQPGEEKTVNIQLDRYATSFWDEIEDMWKSEQGTYEVLIGTSSQEVV
FT                   ARGKFQVDRTSYWRGL"
     atgccgcaga cattcgatgt agagcatgtt ctagcaaaca tcagcgagca ggacaagatc        60
     gctcttttat cagggattga tttctggcac acacatccta tccccgaatt taacgtcccc       120
     tcgattcgcg caaccgacgg tcccaatggt atccggggca cgaaattctt tgccggcatc       180
     cccgccgcat gtttaccctg cggcacagct ctgggcgcca cctgggaccg agatctgata       240
     taccaagcgg gggagctgtt gggtgacgag tgtattgcaa aaggggcgca ttgttggctg       300
     ggtccgacga tcaacatgca gcgcgctccc ctcggtggcc gtgggttcga gtcgttcgcg       360
     gaagatccgc atctctcggg cattctggcc aaatccatca tcctcggatg cgaaagcaaa       420
     ggcgtcattt cgacggtgaa gcatttcgtg ggcaacgacc aggaacatga acgacgggcg       480
     gtggacgttc tcgtcaccca gcgagccttg cgcgagatct acctacgacc cttccaaatt       540
     gtggcaagag atgcaaagcc tggtgccctc atgacctcgt ataataagat caacgggaag       600
     catgtggtgg aagatgagcg catgctcaat ctgatccgcg aggagtggaa gtggaatccg       660
     ctggtcatga gcgactggta cggaacctac acaaccatcg actccatgaa cgcgggcctt       720
     gacctagaaa tgccgggggt gtccaggtac cggggaaagt ttatcgagtc cgccgtacag       780
     gctcgactga tcaagcaatc gactgtcgat gcacgagcgc gaaaggtgtt agaattcgtg       840
     aagcaagcga gtcaggtcca agtatcagaa gtggagcgag gacgggatct cccagaggat       900
     agagcgttga atcgcaaact ctgtgcgaac agcatcgtcc tcctcaagaa cgaaggcatc       960
     ctgccccttc caagggagat caaaaagatc gccctaatcg gatctcatat gaagtgtcct      1020
     gcaatatcgg gtggtggcag tgcgtcactt gagccgtatt actctgtctc gttatacgac      1080
     gcctgtaggg aagcacttcc cgacgcggag gtactctatc aagtgggcgc atacgcccat      1140
     aagatgctcc ccgtgataga ccgtctcttg agcaatgcta tcattcagtt ctacaatgag      1200
     ccgatgtgca aggaacgaca tttaatcagc actgagcctg tatcgacgac ggctttccag      1260
     ttcatggact actacgctcc cggtctcaac cgagcgctct tctgggccac actgattgga      1320
     gacttcacgc ccgacacgtc cgggatttgg gacttcggcc tgagtgtttt tggtaccgca      1380
     aatctctaca tagacgacga gctcgtgatc gataacacca cgagccagac gcgcgggacg      1440
     gcattctttg gcaaaggcac cgttgaggtg ctgggatcga aggaattagt tgctgggact      1500
     atatacaagg ttcggattga gttcggctct gccaatacca ccacgatgaa aacggtgggg      1560
     atggtgaatt tcggtggtgg cgccgcaagt ctgggggcct gtctaaggat gaaccgggag      1620
     gagatgatcg agaatgccgt ggaagccgcc acagaggccg actacaccat tctttgcacc      1680
     gggctcaaca aggactggga atccgaaggg tttgaccgca tgcatatgga tctgccaccg      1740
     ggagttgacg agttgatctc gaaggtgttg aaggccgccg cagacaagac cgtcatcgtc      1800
     aatcagtccg gtacaccagt taccatgccg tgggccgatc aggcccggtg cattgtgcag      1860
     ggctggtacg gaggtaacga gacgggtcat ggaattgccg atgtcctgtt cggagaggtc      1920
     aatccatgcg caaagctgcc cttgtcctgg ccggtggatg tgaaacacaa cccggcctac      1980
     ctgaactacg ccagtgtggg tgggcgagtg ctgtacgggg aggacatcta tgggggctat      2040
     cgattttacg agaagactgg acgagaggtg ctctttccat ttggtcatgg cctgtcatac      2100
     acgaccttca atgtctcacc gaacgttacc gtcgccccgg agatcttcaa catggatgtt      2160
     cctacggtcg ctactgtcca aatcaaaaac acgggcaaac tggcgggcgc ccagattctc      2220
     caactgtaca tttctgctcc cgaatcctca acgccgcgcc caagcaagga actacacggt      2280
     ttcgaaaaag tattcgtgca gcctggggaa gaaaaaacgg ttaacatcca gctggaccga      2340
     tatgcgacca gcttctggga cgagatcgag gacatgtgga agagtgagca ggggacgtac      2400
     gaagtgttga ttgggacctc tagccaggag gtggtagccc gggggaaatt ccaagtggat      2460
     cgcacctcgt attggcgggg actctaa                                          2487
//

If you have problems or comments...

PBIL Back to PBIL home page