(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE31

PENCW_13.PE31        Location/Qualifiers
FT   CDS_pept        join(complement(71528..72116),complement(71318..71476),
FT                   complement(70732..71265),complement(70393..70670))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234827" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128155"
FT                   /orf_name="Pc16g00310"
FT                   /product="Pc16g00310 protein"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAP92701.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016168"
FT                   /db_xref="UniParc:UPI0001831E90"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6T8"
FT                   /transl_table=1
FT                   /translation="MAKMTSIVGILMGVLTTATAASIPTGSSVAAAAALRSLGVSPPSG
FT                   NVLIGNAGYTCSLLNRVFSKNETFTVTSPYYNVLIDEAWSENCRLNASCIVTPESAQEV
FT                   SRLLQILSILRTKFAIRSGGHNTNPGFSSIGSDGVLIALEKLDRLSLSADRGTVTVGPG
FT                   NRWESVYKYLQPYNLTALGGREAVVGVGGYILGDSGGLSTFYNTHGLAIDSVTRFQVVL
FT                   PNGTIVDATPTEHADLYKGLKGGLNNFGIVTEYDLTTNPGVDIYYEIKTYTAANTPAVL
FT                   AAYATYLLDADINSNVEIQVNPSYTLVFYGYLGHVSAPTDFDSFSDIPVASTIYPPTNG
FT                   SLTELLLTIGSTGLTSEGVSYSGTFSFKVTGSTFLQDTYSTYLEAAASLPSGAVLSYVP
FT                   QGVIPNLVTQGKSQNGGNLLGLEATPQIWANIFAQFPATLSQSEVAGAVDSLLANLISS
FT                   AKSEDLFLPYIFVNDAGAKQKPLQSFGEKNIKYIDTVAKRYDPKRVMQKLQDQAYFVSE
FT                   EL"
     atggccaaga tgacctccat agtagggatc cttatgggtg tgctgaccac agccactgcg        60
     gcctccatcc caactggatc ctctgttgct gccgccgctg ctctcaggtc gctgggcgtt       120
     tctcctccat ctggcaacgt tctcatcgga aatgccggct acacctgtag tctcttgaat       180
     cgggtcttct cgaaaaacga aacattcaca gtgacgtcgc cctattacaa cgttttgatc       240
     gacgaagcct ggtcggagaa ttgccgattg aatgcctctt gcatcgtgac gcctgaatct       300
     gcccaagagg tctcgcgtct gttgcagatc ctcagtattc tgcggacgaa atttgccatt       360
     cgctccggtg gacacaatac caacccggga ttcagttcaa tcggtagtga cggggtgttg       420
     atcgctctgg agaagttgga tcgcctttcc ttaagcgctg atcgcggaac tgtcactgtc       480
     ggacctggta atagatggga gtctgtatac aagtacctcc agccgtataa tctcacggcc       540
     ttgggcggtc gcgaagcggt tgtgggtgtt ggtggataca ttcttggtga ctcaggcggt       600
     ctcagcacct tctacaacac ccacggctta gccattgaca gtgtcacccg atttcaggtg       660
     gtcctaccca atggaactat tgtcgatgcc accccaactg agcatgccga tctatacaaa       720
     ggcctgaagg gaggtctgaa caacttcggt atcgtgactg aatatgacct cacgactaat       780
     cccggcgtcg atatctacta tgagataaaa acgtacaccg ctgccaacac accggccgtg       840
     cttgcggcct atgcgacgta tcttttggac gccgacatca acagcaatgt ggagatccag       900
     gtcaacccca gttacacttt ggtcttctat gggtatctcg gtcatgtatc tgcacctacc       960
     gactttgatt cattctccga catacccgtg gcctccacca tatacccacc gacgaacggc      1020
     tcgctcactg agcttctcct caccattggc tccaccggac tgacatccga gggtgtctcg      1080
     tacagcggta ccttttcatt taaagtgacc gggtccactt tcctgcagga cacttactca      1140
     acctatctcg aggccgctgc ctctctcccg tcgggcgcgg tactctctta tgtgcctcag      1200
     ggtgtcattc cgaacctcgt cacccaagga aagtcgcaga atggagggaa cctattgggt      1260
     ttggaggcca cgcctcaaat ctgggcgaat atcttcgctc aattcccagc tacactcagc      1320
     caatcagagg tggcaggtgc tgtagactca ttgctggcca acctcatctc cagcgcaaag      1380
     tcggaggatc ttttcctccc ctatatcttc gtcaatgacg cgggtgccaa gcagaagccg      1440
     ctgcagtcgt ttggagaaaa gaatatcaag tatattgaca cggtcgcgaa aaggtatgac      1500
     cctaagagag tcatgcagaa gctccaggat caggcatact ttgtttcgga ggagttgtaa      1560
//

If you have problems or comments...

PBIL Back to PBIL home page