(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE310

PENCW_13.PE310       Location/Qualifiers
FT   CDS_pept        join(698972..699098,699391..699486,699543..699933,
FT                   699988..700115,700162..700258,700305..701064)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076670" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947684"
FT                   /orf_name="Pc16g03100"
FT                   /product="Pc16g03100 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP92980.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001831CDE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8X2"
FT                   /transl_table=1
FT                   /translation="MDASSTARPRRNTRVLTACDACRLSKTRCDSARPVCAKCVQRDMI
FT                   LSWPIFPKEKSVSTFPMAAYSEKPDRFQTALHSLDPQRLLELREIFMTKIWTKNPIVDP
FT                   DQLDFYIARVLENGVDWSASSCLVLLIFALAAIWGNYPDDETREVSYNEPSFSPPVTYL
FT                   TISVPEHRMKESLTFLSMARKRISTAYLDDTLLGVQCLCLFGIWYQYNIEPIPGWKMFR
FT                   TASMLWQTYRLKHREGKTVRSAQEESLEQRLYWTCLKSEWYSIHHTPQILTQLADIQYL
FT                   SDFPYSLPSFPTRQPSNDSAGWVFSNPSSTDLEAASSYYYLAEIFLRRLLNRARNAVRV
FT                   LSPDIDPPTINTLAETLTQLEGQLQQWVDCLPHTLRFNMPLESAPGPKEGELMKLSRER
FT                   YVEVRELLCRAYLYLCIHVPLDAGMAALYGVKASEALLLAVYRIQTEVPFFRHPGSWGA
FT                   CRVRFNHALCLIAGFRAKLTQRPSAEYVTIPPDWADCVRVVIERLKIWGQEGGGIKELS
FT                   VLLEWLMHGNLELSN"
     atggacgctt cgtcgactgc gcgacctcgc aggaatactc gggtgctcac cgcatgcgat        60
     gcctgtcgtc tcagcaagac tcgatgcgat tcggcacggc cagtgtgtgc caaatgtgtc       120
     cagcgggaca tgatcctcag ctggcctatc tttccaaaag agaagtctgt gtcgactttt       180
     ccaatggcag cgtattccga gaagccagat cgctttcaga cggctctaca cagcttagat       240
     ccacaaagac tcctcgaact gcgcgagatt ttcatgacca agatctggac caagaacccg       300
     atcgttgatc cggaccagct ggacttttat atcgctcgag tgctggaaaa tggcgtcgac       360
     tggtccgcct catcatgttt ggtgctactt atatttgcgc ttgcggccat ctgggggaat       420
     tatccggacg acgaaacgcg cgaggtctcg tacaatgaac catcattcag tccaccggtc       480
     acttatctga cgatatcggt tccggagcac cgaatgaagg aatcattgac cttcctatcc       540
     atggcgcgta agcgcatttc cactgcgtat ctcgacgata ccttactggg agtgcaatgt       600
     ctctgtttat ttggaatttg gtatcagtat aacatcgagc cgattccagg gtggaaaatg       660
     ttccggacag catccatgct gtggcaaacg tatcgtttga agcaccgcga gggaaaaacg       720
     gttagaagtg cgcaggaaga gagtctggag cagcgactgt actggacatg cttaaaatct       780
     gaatggtata gcatacacca cacgcctcaa atcctgacac aattggctga catacaatac       840
     ctctcggatt ttccatattc tctccccagc ttcccaacga gacaaccatc taacgacagc       900
     gctgggtggg tgttttccaa tccctcgtcc acagacctcg aagcagcatc ttcctactat       960
     tatctggccg agatcttctt gcgcaggctt ctcaaccgag cccgtaatgc ggtccgtgtg      1020
     ctctccccgg atatcgaccc gccgaccatc aatactctag cagaaactct gacgcagctg      1080
     gaaggccaac tccagcagtg ggtagactgt ctcccacata cactccggtt caacatgcct      1140
     ctggaatccg cccccggacc gaaggagggt gagctcatga agctaagccg tgagcgatac      1200
     gtggaggtcc gcgaactgct ctgtcgcgcg tacttatacc tgtgcatcca tgtaccactt      1260
     gacgcaggga tggcggcgct gtatggggtc aaagcgagcg aggcgctact tttggcagtg      1320
     tatcgcatcc agactgaggt gccattcttc cggcatccgg gatcatgggg agcttgtcga      1380
     gtccggttca accatgcgct ttgcctgatt gcgggatttc gcgcaaagtt gacgcagcgc      1440
     ccctccgctg aatatgtgac cattcctcct gactgggcgg actgtgtgcg ggtggtgatt      1500
     gagcggttga agatctgggg ccaggagggc ggcgggatca aggagttgag tgtgctcctg      1560
     gagtggttga tgcatggcaa tttggaattg tcgaactaa                             1599
//

If you have problems or comments...

PBIL Back to PBIL home page