(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE311

PENCW_13.PE311       Location/Qualifiers
FT   CDS_pept        join(701821..702031,702164..702304,702354..702615,
FT                   702667..702936,703001..703308,703359..703589,7
FT                   03640..703764)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178887" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671656"
FT                   /orf_name="Pc16g03110"
FT                   /product="Pc16g03110 protein"
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP92981.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831CDF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8X3"
FT                   /transl_table=1
FT                   /translation="MVIVGKQREENLAEPVLANLLADDRTPWYKKPNLRRLYFILFPAC
FT                   MGIEITSGFDSQIINTVQIVYTWNKCAAYSLGAILSLPFVPYVNQLVGRRWTIMFGSGV
FT                   SLVGALIQGFSNGVGMYIVARIILGFGIPFCIVAGSSLLGELGYPKERPILTSLFNSSY
FT                   FIGQIIAAAVGLGTVTIASDWAWRIPSLLQIAPAMVQIATVMFLPESPRYLVSKDRYDD
FT                   AFDILTKYHAEGDRSSTIVKAELAQIERTIKLELEESKQSWWDMFRTAGMRRRLFISAF
FT                   LGLFTQWSGNTLISYYLSDLLNMVGITDGVIKSKINIGIACWGLICGTALALTAPRFKR
FT                   RPMYLTCASALLCVYIAWTISMERFLATKAQSAAIATIFFIFAYSPAYNLGYNALTYTY
FT                   LVELFPYMGRSRGLSWFQFYGRGANFFATYVNPIGLARIAWKWLLVYCCWLLFELVFIY
FT                   FFFPETAGRTLEELSFLFEDKEKANEVAAAVHKQLDEDDEKKTVTAHVEVQDTKNAV"
     atggtcatag tgggaaaaca gcgcgaggag aatcttgccg agcctgtgct ggctaatttg        60
     ctggccgatg accgtacacc ttggtataag aagccgaatc tgagacggct ttatttcata       120
     ttgtttccgg catgtatggg tatcgagatc acgtcgggat tcgactcgca gattatcaac       180
     acggtccaga ttgtgtatac ttggaacaag tgtgctgcat attccctagg agctattctc       240
     tccctgcctt ttgtcccata cgtcaaccag ctagtcggac gacgatggac gatcatgttc       300
     ggttcaggcg tgagcttggt cggggccctt atccagggct tctccaatgg agtgggcatg       360
     tacatagtcg cgcgtatcat tctaggattc ggaattccct tctgcattgt cgcagggtca       420
     tctttgctgg gagagctggg ataccctaag gaacgaccga ttctcacctc gctgttcaac       480
     tcctcctact tcatcggcca gatcatcgcg gcagccgtgg gcctgggaac ggtgaccata       540
     gcgtccgact gggcatggcg catcccatct ttgctccaga ttgcgcccgc catggtccag       600
     atcgcgacgg tgatgttcct ccctgaaagt ccccgatacc tagtcagcaa agaccgctac       660
     gatgacgcct ttgatatcct caccaagtac cacgcggagg gtgaccgcag ctctaccatt       720
     gtcaaggccg aactggcgca gatcgagcgc accatcaagc tggagctcga agagtcaaag       780
     caatcctggt gggacatgtt ccggacagcg ggtatgcgtc gtcgactgtt catctccgct       840
     tttctcggcc tgttcacgca gtggtccggc aacacgctca tttcgtacta tctcagcgac       900
     ctcctgaaca tggtcggaat caccgacggc gtgatcaagt ccaagatcaa catcggcatc       960
     gcctgctggg gtctgatctg tggtactgcg ctggcgctga cagcgccgcg cttcaagcgt      1020
     cggccgatgt acctgacttg cgcaagcgcc ctgctgtgtg tgtacatcgc atggaccatc      1080
     tccatggagc gtttcctggc cacaaaggct caatctgcag caattgcgac catcttcttc      1140
     atttttgcct attcgcctgc ctataacctc ggctataacg ccctaaccta cacgtatctc      1200
     gtcgagctgt tcccttacat gggccgctca cgcggtctct cctggttcca gttctatggc      1260
     cgcggcgcaa acttctttgc cacctacgtg aatcctatcg gcctggcgcg catcgcctgg      1320
     aagtggctac tggtgtactg ctgctggctg ctatttgaac tggtgtttat ctacttcttc      1380
     ttccctgaaa ctgccggccg cactcttgag gaactttctt tcttgtttga ggacaaagag      1440
     aaggccaatg aggttgctgc agccgttcac aaacagctcg acgaagacga cgagaagaaa      1500
     acggtcacgg cacatgtgga ggtccaagac accaagaatg ctgtttaa                   1548
//

If you have problems or comments...

PBIL Back to PBIL home page