(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE312

PENCW_13.PE312       Location/Qualifiers
FT   CDS_pept        complement(704441..705280)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217620" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947685"
FT                   /orf_name="Pc16g03120"
FT                   /product="Pc16g03120 protein"
FT                   /protein_id="CAP92982.1"
FT                   /db_xref="UniParc:UPI0001831DBA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8X4"
FT                   /transl_table=1
FT                   /translation="MPVATLHLLTLAKSTDAQSFLQQLRQSPSTRVIVASRPRHVVIHP
FT                   NILDNDPLASNPWDLLVLLQITQPNAQDPIPSALRGLITNEYIITTGVPSKLLSDYQAR
FT                   DSRLKNDASSIPLTGSLDKVVRGGSKEASQNLEVSPQLLRFMDELWKTHKGPVTMLNLL
FT                   HFHHPDGKKNYYQYGQAFIPVAGKRGGSAKLVGNVVPPAPEKRDSRGSRNRSQQDWWNE
FT                   ISIVHYPSIRHFCDMLAGEDYQAINERYRLSVSALDALLPFISIEFVEWCNDYLGTS"
     atgcctgtcg ctaccctcca cctccttacc cttgccaagt ccacagatgc gcaatcattc        60
     ctccagcaac tcaggcaatc gcccagcact cgagtcatcg tcgcctcgcg tccacgccat       120
     gtcgtaatcc atccaaatat attagacaac gaccctctcg cctcaaatcc atgggacttg       180
     ctagtgctcc tccaaatcac ccagccaaac gcacaagacc caatcccaag cgccttgcgc       240
     gggttaatca cgaacgaata cataataacc accggagtcc cctcgaagct cctctccgac       300
     taccaggcca gagattcccg actcaagaac gatgcctcat ccatacccct cacgggttct       360
     ctggacaagg tcgtccgcgg gggcagcaaa gaggcatcgc agaacctgga agtctcgccc       420
     cagctactga gattcatgga cgaactttgg aagacccata agggacccgt aaccatgcta       480
     aatttacttc atttccacca tcctgatggg aagaagaact actaccagta cgggcaggcc       540
     ttcattcctg tcgcagggaa acgcggcggt agtgccaagt tggtgggcaa tgtggtgcca       600
     ccagcgccgg agaagaggga ttcgcgggga tcgcggaatc ggtcgcagca ggattggtgg       660
     aatgagattt ctatcgtgca ttatccttcc attcgacatt tttgtgatat gctcgctggc       720
     gaggattatc aggctatcaa tgagaggtat cggttgtcgg tgagtgcatt ggatgccctt       780
     ctccctttca tttcgattga gttcgtggaa tggtgtaatg actacttagg cacttcgtga       840
//

If you have problems or comments...

PBIL Back to PBIL home page