(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE313

PENCW_13.PE313       Location/Qualifiers
FT   CDS_pept        complement(705975..706925)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201258" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947686"
FT                   /orf_name="Pc16g03130"
FT                   /product="Pc16g03130 protein"
FT                   /protein_id="CAP92983.1"
FT                   /db_xref="UniParc:UPI0001831DBB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8X5"
FT                   /transl_table=1
FT                   /translation="MAGESGPVEVSRPIAMVIAGLFALACWNVLQILVSIINTFKRRRG
FT                   LYFWSMVIATLGILVHALSTFLRYFALAPNFPMCVLICISWYSMVTGQSVVLYSRLHLV
FT                   TNYDSYSRWVLGMIIFNFCVLHVPTTILFLGINLDVKSFIRPFNIYERVQLAGFAAQET
FT                   IISGLYIWETMTSLRPVLAMKGRRGQKVVINLLVVNTLAVLLDAALLATEYTNHFDVQT
FT                   TLKPVVYSIKLMLEFTVLNSLLLVIRTNPSAIEEVEQLHDDLHIDTGCSGKHFNNTAVF
FT                   IGDPAKSDQGDQGVQISPVRSDPSWISFDHQVKPA"
     atggcaggtg aatcgggtcc tgtcgaggtg tctcggccga ttgcaatggt gattgcaggt        60
     ctcttcgccc tggcgtgttg gaacgtcctc caaatcctcg tttccattat caataccttc       120
     aagcgccgtc gtggccttta tttctggagc atggtgatcg ccaccttggg aattcttgtt       180
     cacgctcttt cgacattcct tcgctacttc gctctcgctc ccaatttccc gatgtgtgtt       240
     ttgatctgca tcagctggta ttccatggtt actggacagt ctgtggtgct gtactcacgg       300
     ctgcatctgg tcacgaacta tgattcctac tcccgctggg tgctaggcat gattatcttc       360
     aacttctgcg tcttgcatgt tcccaccact atcctcttcc ttgggatcaa tctcgacgtc       420
     aaaagcttta tccgcccgtt taatatatac gagcgtgttc aactggctgg attcgccgcc       480
     caggagacga ttatcagtgg tttatacatc tgggaaacca tgactagcct gagacccgtt       540
     ttagcgatga agggccgtcg gggtcagaaa gtcgttatca atctacttgt cgtcaacact       600
     ctcgcggttc tgttggatgc agccctcctg gcgacagagt ataccaatca ttttgacgtg       660
     cagactaccc tcaagccagt cgtctacagt atcaagttga tgctagagtt cacggtactc       720
     aacagtctgc ttcttgtgat ccgcacaaat ccatcggcta ttgaagaagt cgaacaacta       780
     catgatgacc ttcacatcga cacaggatgc agtgggaagc acttcaacaa tactgccgtt       840
     tttatcggcg atccagcaaa gtccgatcaa ggtgatcagg gggtccaaat atcccctgta       900
     agatcagacc cctcttggat ttcgttcgac catcaggtca agcccgcttg a                951
//

If you have problems or comments...

PBIL Back to PBIL home page