(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE314

PENCW_13.PE314       Location/Qualifiers
FT   CDS_pept        join(complement(709150..709432),complement(708377..709089))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000294667" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947687"
FT                   /orf_name="Pc16g03140"
FT                   /product="Pc16g03140 protein"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP92984.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001831DBC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8X6"
FT                   /transl_table=1
FT                   /translation="MSVTFEVFRGSKEGKIVADKTTRTLQPNEVYIETTHSGLCGTDEH
FT                   YLSSGMALGHEGVGIVRQVGRDVTNVKVGARVGYGYTHYVCGNCDKCLTGWDQYCENKK
FT                   EYGSHDHDLGSFSGGTVWDAGCVVPIPDGYDSADAAPLMCAGATVWTCLTEYGVKPTDR
FT                   VAIMGIGGLGHLAIKLASAMGCHVVVLSSSETKREEAFGFGASEYHVFRKGEEMKDFKP
FT                   VNHLLLCGSANVDYPSLIPLMDVHGSIYPLTVDFSHSPVPLLFMNLKGIRIQGSLVASR
FT                   NSLRTLVKFAADKKITPTTMTFPLTKDGVESAMQTLRDGKMRYRGVLVRE"
     atgagcgtca cttttgaagt tttccgcggc tccaaggagg gcaagatcgt ggccgacaag        60
     accacccgca ccctgcagcc caacgaagtc tacatcgaga caacacactc cggtctctgc       120
     ggtacagatg agcactacct ctcttccggc atggctctcg gccacgaggg tgtcggtatc       180
     gttcgccaag tcggccggga cgtcaccaac gtcaaggttg gagctcgtgt cggatacgga       240
     tacacacact acgtttgtgg aaactgtgac aagtgcttga cgggctggga ccaatactgc       300
     gagaataaga aggaatacgg ctcacacgac cacgacctgg gctcgttcag cggcggcacc       360
     gtttgggacg ccggatgcgt cgtccccatc ccggatggct atgactccgc cgatgccgcg       420
     cccttgatgt gcgcaggcgc gactgtctgg acctgtctga cagaatacgg cgtcaagccg       480
     acggaccggg tggctattat gggtatcggc ggtctgggtc acctggccat taaactcgct       540
     tcggcgatgg gctgccatgt tgttgttttg tccagctcag agacgaagcg cgaggaggcc       600
     ttcgggttcg gcgcgtccga gtaccacgtc ttccgcaagg gcgaggaaat gaaggacttc       660
     aagcctgtga accacctgct gctctgcggc agcgccaacg tcgactaccc cagccttatc       720
     ccgctcatgg atgtgcatgg ctcaatctac ccattgactg tcgacttttc tcactcacct       780
     gttccccttc tcttcatgaa cctcaagggt atccgtatcc agggttcgct tgttgcatcg       840
     cgcaacagtc tgcgcacttt ggttaagttc gctgccgata agaagattac cccgactacc       900
     atgaccttcc ccttaaccaa ggatggtgtc gaatctgcta tgcagaccct gcgtgatggc       960
     aagatgagat accgcggtgt tctggtccgg gagtaa                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page