(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE315

PENCW_13.PE315       Location/Qualifiers
FT   CDS_pept        711675..713447
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000149415" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824334"
FT                   /orf_name="Pc16g03150"
FT                   /product="Pc16g03150 protein"
FT                   /function="transferase activity, transferring phosphorus-
FT                   containing groups"
FT                   /biological_process="phosphorylation"
FT                   /protein_id="CAP92985.1"
FT                   /db_xref="GO:0016310"
FT                   /db_xref="GO:0016772"
FT                   /db_xref="InterPro:IPR002840"
FT                   /db_xref="InterPro:IPR007506"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR012047"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="UniParc:UPI0001831DBD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8X7"
FT                   /transl_table=1
FT                   /translation="MGPYVASVFEGTTHVRGKASGTLIASGLELSFWGGVNSQTGEVID
FT                   RHHDLSGHYLQDTVLAIPGGRGSCSGSGVMLELLLNNKGPKAILFERQDDILTLGVMVA
FT                   EEIFGKAIPVVTMKPNDFRAILGMRGKIIYIDSDRVSDAPFHDTHPDHTQEPTKNYFVD
FT                   GMQMSDFDKELLQGLHGEASCTAIRIILRMASLLGATELMNVTQVHVDCCLYTGPGSLL
FT                   FAEKLRDWGGKVRVPTTLNSISIDQNRWREQGVGNSFGEAATKLANAYTDMGATPTFTC
FT                   APYQLKTAPRQGEQVAWAESNAVVYANSVLGARTMKYPDFLDICIALTGRAPRGGAHLD
FT                   INRLASLILRVGLPDVDTIDDSFYPILGYKVGSLAANRIPVIVGLQTLAPSRDDLKAFG
FT                   AAFATVSSAPMFHMLGVTPEATSLSAVVDEARQIPSVDIKMEHLIDDWQRLNSASEQQA
FT                   IDLVSLGNPHFSFKEMKRLAHLCEGRTKAQEVSVIVTCGRSSYGLASQAGVVELLENFG
FT                   VKFMTDTCWCMITEPIVPATTNAIMTNSAKYAHYGPGLTERKFFLGSLMQCVEAACRTS
FT                   YTKEMPQWLLNTDD"
     atgggcccat acgtcgcatc ggtttttgaa gggacgaccc atgtcagagg caaggcttct        60
     ggaacactca ttgcaagtgg cctagagcta agcttctggg gcggtgtcaa ttctcagaca       120
     ggagaggtta ttgaccgtca tcatgacttg agcggccact atctccagga tactgtcctt       180
     gccattcccg gtggccgggg gtcatgctct gggagtgggg ttatgctgga acttctcctc       240
     aacaacaaag gaccgaaggc cattctattc gagagacaag atgacattct cactctcggc       300
     gtgatggttg cggaagagat cttcggcaaa gccataccag tggtcacgat gaagccgaac       360
     gatttccggg cgattctggg catgagagga aagatcatct acattgattc cgaccgcgtt       420
     tctgatgcac cctttcatga tacacacccg gaccacacac aagaacccac caaaaattac       480
     ttcgtcgacg gtatgcagat gtcagacttc gataaagaat tgcttcaagg acttcacggg       540
     gaggcctctt gtactgcaat ccgcatcatt ttgcgaatgg caagcctact aggagccact       600
     gaattaatga atgtgaccca ggtccatgtg gactgctgcc tttatacagg gcccgggtct       660
     cttctgtttg cagaaaagct ccgggactgg ggaggaaagg tccgagttcc aacaacgctg       720
     aattccatct ctatcgatca gaatcgttgg cgtgaacaag gcgttggcaa ctcatttgga       780
     gaagcagcca caaaattagc gaatgcctac accgacatgg gcgctacgcc aacatttacc       840
     tgtgcgccat accagcttaa gacggcacca aggcaaggag aacaagtggc ttgggcggaa       900
     tcaaatgcgg tcgtctacgc taatagcgta cttggggctc gaaccatgaa atatccagat       960
     ttcctggata tatgtatcgc cctcactggg cgagctccta gagggggagc gcatttggac      1020
     ataaacagac tggcatccct tattttgaga gttggtcttc cggatgtgga cactattgac      1080
     gattccttct accccatact gggctacaaa gttggtagtc ttgctgcaaa ccggatcccc      1140
     gtgattgttg ggctacagac actggcaccg tcgagagacg atttgaaggc ctttggcgct      1200
     gcgtttgcaa ctgtttctag tgcgcccatg ttccatatgc tgggcgtcac ccccgaggca      1260
     acttcactta gtgccgtcgt ggacgaagcg cgtcaaatac catctgtgga tatcaaaatg      1320
     gaacatctga ttgacgactg gcagaggcta aatagtgcat ccgagcaaca ggctatcgat      1380
     ctggtctccc tcggcaaccc acatttttca ttcaaagaaa tgaaaaggct agctcacctc      1440
     tgtgaaggcc gaaccaaggc acaggaggtt tcagtcatag taacatgtgg ccgatcttct      1500
     tatggcttag cctcccaagc aggggtggta gaattactgg agaattttgg cgttaaattt      1560
     atgactgata cttgctggtg catgatcacg gagccgatag ttccggcaac tacgaatgct      1620
     atcatgacaa attctgcgaa gtatgctcat tacgggccgg gtctgacgga acggaagttc      1680
     tttttgggga gcctcatgca atgtgtcgag gcggcatgcc gaaccagcta taccaaggag      1740
     atgccccaat ggctgctgaa tacagatgat taa                                   1773
//

If you have problems or comments...

PBIL Back to PBIL home page