(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE318

PENCW_13.PE318       Location/Qualifiers
FT   CDS_pept        join(complement(719171..719221),complement(718937..719077),
FT                   complement(718740..718859),complement(718498..718667),
FT                   complement(718197..718256),complement(718056..718147),
FT                   complement(717866..717966))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824335"
FT                   /orf_name="Pc16g03180"
FT                   /product="Putative uncharacterized protein Pc16g03180 "
FT                   /protein_id="CAP92988.1"
FT                   /db_xref="UniParc:UPI0001831DC0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Y0"
FT                   /transl_table=1
FT                   /translation="MAIYSAGYLTTSYVRILEDRHVKIETMPVLEQKTGPLYPEILAIM
FT                   RRYNLNVASAFQCGKMTMATPLANTRNLRMHPPPYPGGDSRPDPFWASQPGHHECCCSV
FT                   QRGQCAGGDKLGNLRVKNDTVICETTTAFALGDVVAPRSLVLMPRARRFFTHNRDKKPA
FT                   DIRSAKSISGSESGLLHKLPRSKHDMRVQPRQENIVLHFMSNRYGRVPGPQMPYAMFQI
FT                   WAIPYPYALYGDIDCRGRQSSY"
     atggcgattt attctgccgg atacctcact acttcatacg tcaggattct ggaggaccgg        60
     catgtgaaaa tagagaccat gcctgtcctg gaacagaaaa ccggtccgct ttacccagag       120
     atcctggcta ttatgcgccg ttacaatctg aatgtcgcct cagcattcca atgcgggaag       180
     atgactatgg ccaccccgct cgccaacacg agaaacctgc gcatgcaccc acctccatac       240
     ccggggggcg atagtcgccc cgatccattc tgggcgagtc agccagggca ccatgaatgc       300
     tgctgttccg tgcaaagagg acaatgcgcc ggaggggaca agctagggaa cctgcgtgtc       360
     aaaaatgaca ccgttatctg tgagaccact acagccttcg cacttggcga tgttgttgct       420
     cctcgctccc ttgttttgat gccacgagcc cgccgattct ttactcacaa cagggataag       480
     aagccggcgg atattcggtc tgctaaatcc atatctggaa gtgaaagtgg gcttcttcac       540
     aaacttccaa gatctaaaca cgacatgcgg gtccagcctc ggcaagagaa catcgtcttg       600
     cattttatgt caaacagata tggcagagtc ccagggcctc aaatgccata tgcgatgttc       660
     caaatttggg ccataccata tccctacgct ttgtatggag acatcgattg ccgaggtcgt       720
     caatcatcct attaa                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page