(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE32

PENCW_13.PE32        Location/Qualifiers
FT   CDS_pept        join(72462..73015,73073..73295)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671088"
FT                   /orf_name="Pc16g00320"
FT                   /product="Pc16g00320 protein"
FT                   /protein_id="CAP92702.1"
FT                   /db_xref="UniParc:UPI0001831E91"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6U3"
FT                   /transl_table=1
FT                   /translation="MGFFALEEWAAANRDYENTRAPYWHVKSVPDGFTAISGILWSISY
FT                   TLMAKKAFKDRSYAMPLHCLCLNITWEAVYGFVYGPGLLNQVVFAQWMIVDVVLFYAIL
FT                   RSAPYVWKQSPLVAQHLAGIIVVGCVICLWLHLAIAATFIPSIGRQVVFMTAWPMQVLI
FT                   NFSSIAQLLSRGNTLGHSWGIWWTRMLGTIAAACCFFWRIHYWPERFGYAWTPYGQFLL
FT                   LGSIGSDMVYAVVYIYVQRMEKQLDTLVSTKAQKAR"
     atgggcttct tcgcgctcga ggagtgggca gccgccaatc gtgactatga gaatacccgg        60
     gcgccctact ggcatgtgaa gtctgtaccc gatggcttca ctgccatatc aggaatactc       120
     tggtccatct cgtatacctt aatggccaaa aaggctttta aagatcgttc ctacgcaatg       180
     cctctccatt gtctctgctt gaacattacc tgggaagcag tctacgggtt tgtctacggc       240
     ccagggctgt taaaccaggt tgtgttcgct caatggatga tcgtcgacgt ggtcctcttc       300
     tacgcaattc ttcgatcggc cccgtatgtc tggaagcagt ccccattagt ggcgcagcat       360
     ctcgcgggta taatcgtggt cggatgtgtg atctgcctgt ggctgcactt ggcgatcgcg       420
     gccacattta tcccgagcat tgggcgacag gtcgtgttca tgacggcatg gcctatgcag       480
     gtccttatca atttcagttc gattgcgcag ctactctcgc gcggaaatac ccttggtcac       540
     tcttggggaa tttggtggac aagaatgttg ggtactatcg ccgctgcatg ttgcttcttc       600
     tggcgtatac actattggcc agagcgattc ggatatgcgt ggacccctta tgggcagttt       660
     ttgctgctgg gtagtatcgg gtctgacatg gtgtatgctg tggtctacat ctatgttcag       720
     agaatggaga agcagctgga caccctggtc agcaccaagg cgcagaaggc tcgttga          777
//

If you have problems or comments...

PBIL Back to PBIL home page