(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE321

PENCW_13.PE321       Location/Qualifiers
FT   CDS_pept        join(722187..722881,722934..723021,723090..723917)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824336"
FT                   /orf_name="Pc16g03210"
FT                   /product="Pc16g03210 protein"
FT                   /protein_id="CAP92991.1"
FT                   /db_xref="UniParc:UPI0001831DC1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Y1"
FT                   /transl_table=1
FT                   /translation="MSSTTPETMTQRSPVSTKVEHEDFLMNKIIEQFRQLTFDPDFQKA
FT                   SATYSQVKDQQDQIQIRDEKLDKLQKHIKAQEENELVALSRFSAVNQALTTQKEKAEKE
FT                   NASLRKAVIEREKSLTEISRRIQELQGQIQTQLSERSQDERRMTSIIAQHKLDIGSLQR
FT                   RLTERDTSVDEMKATTANLESLLAKEQTKSVCLETEKKSLDENMQMARSRLEKFDAFIL
FT                   ESHQIDEQSIIDRFEGIWDYAINEIWTVLRQNLSDENLKNDRAWKKFRLDTAAAIRDGA
FT                   IQGQPAPLSASNSDAAKGMRLAVMLGILSREIDNEIFQPSYFPSETGNFRMSLNKLAKS
FT                   DNEKERFYRSVLLSIDRDGQETELQSRAKSVVQNVSHYLYELLSTAQYGELKERIKNVV
FT                   DRAIEVWRPIQNSTKRYETEFDPVDWAHDEDSLFQFPVGGEDTIGAEHQDDHLCVIFPG
FT                   LFSLERDDALILTSVVPLMSSQRLYVAANQELREEVRGQSSPTTKQPSRKRQNSVAKAQ
FT                   SQSNGIGFLGGHSSGGSSN"
     atgtcttcaa caacacctga aacaatgacg caacgctcgc ccgtctctac taaggtggaa        60
     catgaagatt tcttgatgaa caaaatcatt gagcaattca gacaactcac tttcgatcct       120
     gatttccaga aagcgtcggc gacttatagt caggttaaag accagcagga ccaaatccag       180
     attcgagacg aaaagctgga caaattgcag aagcatatca aagctcaaga agagaatgag       240
     ttggttgcgc tcagcagatt ttctgcagtg aaccaagcct tgaccaccca gaaagaaaag       300
     gcagaaaaag aaaatgcttc tcttcgaaaa gcggttatag aaagagagaa atctctgact       360
     gagatctctc gaaggattca agaactccaa gggcaaatac aaacacagct gtctgaaaga       420
     tcgcaggacg aaaggaggat gacctcaata attgcacaac acaaacttga tattggttcc       480
     cttcagagaa gacttacaga aagagataca tcggttgacg aaatgaaggc tactaccgca       540
     aaccttgaga gcctccttgc taaggaacaa acgaaaagcg tgtgccttga aacagagaag       600
     aagtcgcttg atgaaaacat gcaaatggct cgcagtcgac tcgaaaagtt cgatgctttt       660
     atccttgaat ctcaccaaat tgatgagcag tcaataattg ataggtttga gggcatctgg       720
     gactacgcaa taaatgaaat ttggaccgtc ttgcgccaga atttgagcga cgagaatctc       780
     aaaaatgata gagcctggaa gaagttcaga ctggatactg ctgctgctat ccgagatggg       840
     gcaatccaag ggcagcctgc ccccctgagt gcttcgaatt ccgatgccgc taagggaatg       900
     cgtttggctg tgatgttggg cattctatcc agggaaattg acaacgagat ttttcaaccg       960
     agctactttc cgtccgagac cggtaatttc aggatgagct tgaataagct tgcgaaaagt      1020
     gacaacgaaa aagaacgttt ttatcgctcc gtcctgcttt ctattgatcg tgacgggcag      1080
     gaaactgaac ttcagtctag ggccaaatct gttgttcaaa atgtgtccca ctatctttat      1140
     gagcttcttt caactgccca gtatggtgag ctcaaagaga ggataaagaa cgttgttgat      1200
     agggcaatcg aggtctggcg tcctattcag aattccacga aaagatatga gacggaattt      1260
     gatccagtcg attgggccca cgatgaggat tctctattcc agtttcccgt gggtggtgaa      1320
     gataccatcg gggctgagca tcaagacgac cacctttgtg tcattttccc tggattattt      1380
     tccttggaac gtgatgatgc cttgattttg acttccgtcg ttccactcat gagctctcag      1440
     agattatatg ttgctgccaa tcaagaactg agggaagaag ttcgagggca atctagccca      1500
     acaactaaac aacccagtcg taaaaggcag aactctgttg ctaaagctca atcgcagtca      1560
     aacgggattg gttttttagg aggacactcc tccggaggct cgagcaatta a               1611
//

If you have problems or comments...

PBIL Back to PBIL home page