(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE322

PENCW_13.PE322       Location/Qualifiers
FT   CDS_pept        join(complement(730307..730464),complement(730145..730247),
FT                   complement(729900..730085),complement(729748..729848),
FT                   complement(729553..729692),complement(729424..729485),
FT                   complement(729247..729383),complement(729075..729192),
FT                   complement(728871..729024),complement(728545..728809),
FT                   complement(728439..728493),complement(728160..728364),
FT                   complement(727869..728104),complement(727456..727818))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977568"
FT                   /orf_name="Pc16g03220"
FT                   /product="Pc16g03220 protein"
FT                   /protein_id="CAP92992.1"
FT                   /db_xref="InterPro:IPR020864"
FT                   /db_xref="UniParc:UPI0001831DC2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Y2"
FT                   /transl_table=1
FT                   /translation="MGESKENLFNVWTYDKAEKTKITDRIVIGSIKDNATLADIREALI
FT                   KSKLDSKKARFPFCSKDGARIGDDAKWQLYKELTAGAPTKQSSKNGDDEQPTEGASKEG
FT                   DTPTLSITAHDVYFELSEEETNRKYGELGANVQKLLDTPLDLELGKDKVNLLRANIADF
FT                   ELEGYNHKQWKSKASSTDAISAGSLSDADWDIVSRTTHFLNGHRMVFLENAGGRRKFQR
FT                   IDKAPYPARSLDEMGMAGPNVTLPTDNPKTKILYKYPLYTVTDDSYVNVFETANALSNS
FT                   LASSNFSSMDVEASIGGGLFGYSAAAKGGFSKSDSDALATSEQSKQRTMNITYNFPRVV
FT                   LHLDNDTLELTKGCKEALDHIIKLREDPKVASWQERRAIIKFYQKFGHFFATNVELGGK
FT                   LFSKEEFSSSDVGKTAEKSNAMKISAALSFSSPVVQASASYSQESQSASGSASQTSNMS
FT                   KALSWEAVGGDTTLCNNPPEWSSTVKPFKNWRVINQKDVMAIAEFIGTFPDYGKIPEMF
FT                   KMISNESSQKTPCRFLLQADPGDDGKIKGIQYYGLRKDNGQTRNEGMFDTLRDWCLKDE
FT                   EVVNAFGVDGINKSTNNAKYKFKQDTYTDGWHEWVGIDPQSSRTVGGGCIFELDVETQL
FT                   GRPPRLTYNTPYKLFNKATKSYLAADVGWDAKIAGRTMGLLFYSRSDARIGTFVFQKAN
FT                   QPSATGTIDEGANVSLHLCDENNVPIGQVKRNINDQSTLGVERSDCELKFLFVTNNAYM
FT                   RYDESDN"
     atgggtgaaa gtaaagaaaa ccttttcaac gtctggacct atgataaggc cgaaaagaca        60
     aagatcacgg atcgcattgt catagggtcc attaaagata acgcgacctt ggcggacatt       120
     cgagaagcgc ttattaaaag caagctcgac tccaaaaagg cccgttttcc tttctgctcc       180
     aaggatggcg cccgcatagg ggatgacgcc aaatggcaac tctataagga actcactgcg       240
     ggggccccta caaaacaaag cagcaaaaat ggagacgacg agcaacccac agaaggggct       300
     tccaaggaag gtgacacccc tactcttagt atcaccgctc atgatgtgta ttttgagctt       360
     tctgaggagg aaaccaaccg aaagtatggt gaactcggcg ccaacgtcca gaagctgctt       420
     gatactccat tggatctgga gcttggtaaa gacaaggtga atttgctcag ggcgaacatt       480
     gcggactttg aactggaagg ttacaatcat aagcagtgga agtcgaaggc tagtagtact       540
     gatgcaatct ccgccggctc cctatcggac gcagattggg acatagtttc tcgaaccacc       600
     catttcttga atggtcatcg aatggttttc ttggaaaacg caggtggccg aaggaagttc       660
     caaagaatcg ataaagcgcc atatcctgcg aggagcctcg atgagatggg aatggccggc       720
     cctaacgtca cacttccaac cgataatcca aaaacgaaga tcttgtacaa gtatccttta       780
     tacactgtca cggatgactc ctatgtcaat gtgtttgaaa ctgccaatgc tctttccaac       840
     agccttgcat caagcaactt ttcatccatg gatgttgagg cttcaatcgg aggagggctt       900
     ttcggctaca gtgctgctgc caagggtgga ttcagcaaaa gtgactctga cgcccttgct       960
     accagcgaac aaagcaagca acgaaccatg aatatcacat acaattttcc gagagtggtt      1020
     ctgcatttgg ataacgacac cttggagctg actaagggct gcaaggaagc cttggaccac      1080
     attatcaagc tcagagagga cccgaaggtg gcaagttggc aagaaaggag agctataatc      1140
     aaattctatc agaagtttgg acatttcttt gccaccaacg tggaactagg tgggaagttg      1200
     ttttcaaagg aggaattcag ttcatccgat gtggggaaaa cggcagagaa gtcaaatgcc      1260
     atgaagatta gcgcggcgct atctttttct tccccagtgg tgcaggcctc tgctagctac      1320
     agccaggaaa gccagagcgc gtcaggtagc gctagccaga ccagcaacat gagcaaagca      1380
     ctttcttggg aagctgtggg tggggatacg acactttgca acaatcctcc ggagtggagt      1440
     tctacagtca agcccttcaa gaactggaga gtcatcaacc aaaaggacgt tatggcaatt      1500
     gcagagttta ttgggacatt ccctgattat ggtaaaatcc ccgaaatgtt caaaatgatc      1560
     agcaacgagt cctcccaaaa aacgccttgt cgcttcctcc tccaagcgga ccctggtgat      1620
     gacggaaaaa tcaagggaat ccagtactat ggccttcgca aggataatgg tcaaacgaga      1680
     aatgagggaa tgtttgatac gttaagggac tggtgtctaa aggacgagga agtcgtcaat      1740
     gcctttggcg tcgacgggat taacaaatca accaacaatg ccaagtataa attcaaacag      1800
     gacacatata cagatggctg gcatgagtgg gtcggaattg atccgcaaag ctcgcgcacg      1860
     gtaggaggcg gctgtatatt tgagctcgac gttgagacac aacttgggcg accaccaagg      1920
     ttgacataca acacgccata caaattgttc aacaaagcga ccaaaagtta tttggcagcg      1980
     gacgttggct gggatgcgaa aattgctggc aggaccatgg ggcttctgtt ttacagcagg      2040
     tccgacgcga gaatcgggac atttgtgttc caaaaggcga accagcccag tgctactggc      2100
     acgattgacg agggcgctaa tgtctcactt cacttatgcg acgaaaataa cgttcccatc      2160
     ggacaggtga agcgcaatat aaacgaccag tcaacgctag gcgtcgagcg aagtgattgc      2220
     gagctgaaat tcctcttcgt cacaaacaac gcatatatga gatacgatga gagtgacaac      2280
     tga                                                                    2283
//

If you have problems or comments...

PBIL Back to PBIL home page