(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE323

PENCW_13.PE323       Location/Qualifiers
FT   CDS_pept        complement(732278..733354)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076671" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947690"
FT                   /orf_name="Pc16g03230"
FT                   /product="Pc16g03230 protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP92993.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI0001831DC3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Y3"
FT                   /transl_table=1
FT                   /translation="MAPLSEIIKLEPEREPWCAGYAPSQGRRCHARTNARGRSSAMMLL
FT                   NDGSKDLRVGRNIDTLLEDLAPHVLCIRFHKSQASDLVRRWKRQVRTYLDSQVVSTPYT
FT                   RPVRTSSQRIFEPAEANMEERIAILHQELRDAEEEVRRLKLAQSGLPVNTNPRHYEGRN
FT                   MSAVVNSSSTGSTSSRNPPVNCLNETLRGDLTESSTNRSAIAVPRPVQAQASRQTSAAS
FT                   ISSTRSLNTATMPRIFSSPGNTASQGETFQPNRREIEGECGICLNDLDGPQDEDLDAGE
FT                   GSENSGGYDHGDNDQDKDDEEDNYDGYDDDGDDDEPLNELVWCKARCGVNFHKRCIDQW
FT                   LETDQAPTCPACRSNWKH"
     atggctcctc tatccgaaat catcaaactc gaaccggaga gagaaccttg gtgcgccggc        60
     tacgctcctt cacagggccg tcgttgtcac gcccgcacaa atgcacgcgg tcgcagttcg       120
     gcaatgatgc ttctcaacga tggtagcaaa gatcttcgag tcggtagaaa catcgataca       180
     ctgctagaag atttagcccc tcatgtttta tgcataaggt tccacaagag ccaagcttcg       240
     gatcttgtgc gtcgttggaa aagacaagtc cgtacatatc tcgattcgca ggtggtttca       300
     acgccatata cacggccagt gagaacatca tcccaaagga tcttcgagcc cgctgaggcg       360
     aatatggagg agagaattgc tattcttcat caagagcttc gtgatgccga ggaagaggtc       420
     aggcgcctta agctcgctca atctggccta ccggtcaata caaacccgcg tcattacgag       480
     ggtagaaaca tgagcgcagt cgtcaattcc agcagcacag gaagcacatc aagcagaaat       540
     cctcctgtaa attgtcttaa cgagacattg agaggagact taacagaatc ttctaccaac       600
     cggtcagcaa tcgccgtacc tcgaccagtt caagctcaag ccagtcgtca aacaagtgct       660
     gcctctattt cgagtacaag atcattgaac acagcaacta tgcctcgcat tttcagtagc       720
     cctggtaaca cggccagcca gggtgaaaca tttcagccca atcgccgaga gatcgaagga       780
     gaatgtggta tctgtttgaa cgatttggat ggtcctcaag atgaggactt ggacgcagga       840
     gaggggagcg agaacagtgg tggctatgac catggtgata atgatcaaga caaagatgat       900
     gaggaggata attatgatgg ttatgatgac gatggggacg atgatgaacc ccttaacgaa       960
     ttggtttggt gcaaggcacg ctgtggagtc aacttccaca aacggtgcat cgaccaatgg      1020
     ctagaaacag atcaagctcc cacctgtccg gcatgtagga gtaattggaa acattga         1077
//

If you have problems or comments...

PBIL Back to PBIL home page