(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE324

PENCW_13.PE324       Location/Qualifiers
FT   CDS_pept        join(737147..737190,737258..737410,737470..737545)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000166313" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947691"
FT                   /orf_name="Pc16g03240"
FT                   /product="Pc16g03240 protein"
FT                   /protein_id="CAP92994.1"
FT                   /db_xref="InterPro:IPR018824"
FT                   /db_xref="UniParc:UPI0001831DC4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Y4"
FT                   /transl_table=1
FT                   /translation="MSTEDRLNQMRGYKATLSNPNVSEEAKQNAQAMLNELGGDQPREE
FT                   LYQARGDQNKDPMRVSAGLKAAQHNPGVTEGGKQEAAEKMEGPGD"
     atgtcaacag aagacaggct caatcagatg cgtgggtaca aggccacgct gagcaacccc        60
     aacgtttcag aagaggcaaa gcagaatgct caagctatgc tgaatgagct cggcggtgat       120
     caacctcgcg aggaactata tcaggcaaga ggcgatcaaa acaaagaccc aatgagggtc       180
     tcagctgggc ttaaggcggc gcagcacaac cctggtgtga cagaaggcgg gaagcaagaa       240
     gctgctgaga agatggaagg gccgggggat taa                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page