(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE325

PENCW_13.PE325       Location/Qualifiers
FT   CDS_pept        join(739329..739937,739986..740216)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000288287" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824337"
FT                   /orf_name="Pc16g03250"
FT                   /product="Pc16g03250 protein"
FT                   /function="transporter activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP92995.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="UniParc:UPI0001831DC5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Y5"
FT                   /transl_table=1
FT                   /translation="MIHRRVLKPYAAEFLGTALLIVIGDGVVAQCLLSDYNYGTWLSIN
FT                   VAWAAAVSLSSYLSDPSPTINPAVTLCLALVRPYEGQWKQVPGKLAAQFLGGFVGAAIV
FT                   YINYRSAIKAWDPEYTIPGGSILSPVGHHSAGIFSTYPGAFFESNWEAVFSEMLGSAVL
FT                   MFGCLSISDPRNAHRLPAPQIALFLLLLMIGAALGWQTGYAINPARDFGPRLFSAIIYG
FT                   REVFTAANCYFVVPLFAPIVGCVLGAATYDGMLFEGEGSRIADALDEAENHGSLRLQ"
     atgatccatc gccgggtact gaagccgtat gcggccgaat tcctcggaac tgctctgcta        60
     atcgtcatcg gggatggagt agtcgcgcaa tgcctattgt ccgactacaa ttacggcacc       120
     tggctgtcca tcaacgtcgc ctgggctgct gccgtctccc tctctagcta cttgtctgat       180
     cccagtccca ccatcaaccc ggcagtgact ctctgtcttg ctcttgtgcg tccatatgaa       240
     gggcagtgga aacaggtccc cggcaagctt gctgctcagt tcctgggcgg atttgtcggc       300
     gctgccatcg tatatatcaa ctaccgttca gccatcaaag cttgggaccc cgaatacacc       360
     attcccggcg gatcgatcct gagcccggtc ggtcatcact cggcggggat cttctcgacc       420
     taccctggtg ccttcttcga gtcgaactgg gaggctgtat tttctgagat gctgggctcg       480
     gctgtgttga tgtttggctg tctcagcatc tccgacccga gaaatgctca tcgattgcct       540
     gctccacaga tcgctctctt tctgctactg cttatgatcg gggcggcttt gggctggcag       600
     accggctacg ccattaaccc agctagagac tttgggccga gattgttctc tgctatcatc       660
     tatggccggg aggtgttcac ggcagccaat tgctatttcg ttgttcccct cttcgcccct       720
     attgttggct gtgttttggg tgcggcgact tacgacggga tgctgtttga gggagagggg       780
     tcgcgcattg ccgatgcgct ggacgaagcc gagaaccatg ggtctcttcg tctgcagtga       840
//

If you have problems or comments...

PBIL Back to PBIL home page