(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE326

PENCW_13.PE326       Location/Qualifiers
FT   CDS_pept        join(complement(741607..741695),complement(741494..741547),
FT                   complement(740462..741422))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000046976" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947692"
FT                   /orf_name="Pc16g03260"
FT                   /product="Pc16g03260 protein"
FT                   /EC_number="4.3.1.17"
FT                   /function="L-serine ammonia-lyase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="CAP92996.1"
FT                   /db_xref="GO:0003941"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="UniParc:UPI0001831DC6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Y6"
FT                   /transl_table=1
FT                   /translation="MGHFDKHELKKPWIETPLIESATLSKAAGCRIFLKLESLQPSGSF
FT                   KSRGIGNLILTSLSDPSNNGRTLHFFSSSAGNAGMAAVIAARDLGCPCTVVVPLSVKPT
FT                   MIEKIRAAGASDVIRHGASWFEADAYLRENFIENEDSKLDPLVRNIYVPPFDHHDIWRG
FT                   AGTLIDEIVKQLPRHNGEPDTDRSFPADAIVCSVGGGGLLNGIIDGLERHLPAYQPRTL
FT                   PNKEAKKVRVLAAETAGADSLAHSVRKSYLHTLPAITSQAITLGALCVARQTLKNAQSP
FT                   PPGVEVTSIVGTDADAAKGVVRLCDELRLEVELACGISVQVGLDRLREVMPELTPDSRV
FT                   IIIVCGGNDVSPEIISDYRQKLANGWR"
     atgggccatt tcgataaaca cgaattgaag aaaccctgga ttgaaacgcc tttgatcgag        60
     tcggcgacac tttcaaaggc tgccggatgt agaatttttc tcaaattaga gtcactccaa       120
     ccgtctggct cattcaaatc gcgaggcatt ggaaacttaa tcctcacctc tctttccgat       180
     ccatcaaaca atggcagaac cctgcatttt ttcagctcct cggctggcaa tgcggggatg       240
     gcagcagtca tagccgcccg ggatctcggt tgtccctgta cagttgttgt tccacttagc       300
     gtgaagccta ctatgatcga aaaaattcgt gctgcagggg cttccgatgt tatccgccat       360
     ggtgccagtt ggtttgaagc agacgcatat ctgcgggaga atttcatcga aaatgaagac       420
     agcaagttgg atcccttggt caggaacatt tatgtcccac cattcgatca tcatgacatc       480
     tggcgaggtg cagggactct gattgatgag atagttaagc aattaccaag gcacaatggc       540
     gaacccgata ccgatcgttc tttcccggca gatgcaattg tttgcagcgt tggtggtggc       600
     ggtcttttga acgggattat cgacggcctt gagaggcatt tgccagccta tcaaccgaga       660
     acgcttccta acaaagaggc gaagaaagtt cgagttctcg ctgctgaaac agctggggcg       720
     gactcgttgg cgcactcggt acgcaagagt tatctgcaca ctctacctgc catcacatca       780
     caggcaatca ccctgggggc actctgcgtg gcacggcaga cgctgaaaaa cgcgcaatcc       840
     cctccgcctg gtgttgaagt cactagtatt gtgggcaccg atgctgatgc tgcgaaggga       900
     gttgtgcggt tgtgtgatga gctgcggttg gaggtcgagc tggcttgcgg aataagtgtc       960
     caagttgggt tagataggct aagggaagtc atgccagaac tcacaccgga tagtcgagtt      1020
     atcatcattg tgtgcggagg aaacgatgtt tctcctgaaa ttatttcgga ttaccgccag      1080
     aagcttgcca atggttggcg atga                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page