(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE327

PENCW_13.PE327       Location/Qualifiers
FT   CDS_pept        join(complement(742485..742987),complement(742138..742417))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824338"
FT                   /orf_name="Pc16g03270"
FT                   /product="Putative uncharacterized protein Pc16g03270 "
FT                   /protein_id="CAP92997.1"
FT                   /db_xref="UniParc:UPI0001831DC7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Y7"
FT                   /transl_table=1
FT                   /translation="MYKVFTLISLFLPVHVTATPQNHDHALLRRDACDGIDSMPVLYHD
FT                   YLSDVCPPKHLNNSEGICDHVDYRSNSCVGFCQLRTRFVYGREFPLDVWCNGPPCKIAD
FT                   FTRIMTRSVDIEPQFEKGLNDGISGGWQSKTTADVGPRGMSYKMPLKAGQCGYWSWVPI
FT                   KKTVCGTMSYQQTEAHRCVDDMHTVENYCVDALQRYPDGTVDGETIFVYTDCMTRLPLP
FT                   MDQQTIIYRLPGVALNQGEHPSAQELGGYPSDSEQQVL"
     atgtataaag tttttacttt gatatctctt ttcctccctg tgcatgtgac tgcaacgcct        60
     cagaaccatg accatgcgct cctccgtagg gacgcttgcg atgggattga cagcatgcca       120
     gttctctacc acgattatct aagtgatgta tgcccaccaa agcatctgaa caactcggag       180
     ggcatttgcg accatgtgga ctacaggtcg aattcttgcg tggggttctg ccaactcaga       240
     actcgctttg tttatgggag ggagtttccc ttggatgttt ggtgcaatgg gcctccttgt       300
     aaaattgccg attttaccag gataatgact cggtctgtag atatagagcc ccagttcgag       360
     aaaggcttga atgatgggat tagtggaggt tggcagtcaa agaccacagc tgatgtggga       420
     cctcggggta tgtcttacaa gatgcctttg aaagctggac agtgtgggta ctggagctgg       480
     gttcctatca agaaaactgt gtgtgggaca atgtcctacc aacaaaccga agcgcaccgc       540
     tgcgtggatg atatgcacac cgttgagaac tactgtgtag atgctctaca acgatatccc       600
     gatggcactg tcgacggaga aacgatcttt gtctacactg actgcatgac acgacttccg       660
     ttgccgatgg atcagcagac tatcatatat aggctgccgg gagtcgctct gaatcagggt       720
     gaacatccct cagctcagga attgggcggc tatccttcag actcggaaca gcaagtgttg       780
     tga                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page