(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE33

PENCW_13.PE33        Location/Qualifiers
FT   CDS_pept        join(complement(73846..74340),complement(73504..73791))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000185387" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945516"
FT                   /orf_name="Pc16g00330"
FT                   /product="Pc16g00330 protein"
FT                   /protein_id="CAP92703.1"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI0001831E92"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6U4"
FT                   /transl_table=1
FT                   /translation="MAPCKPRTFTAGQVPLTKFDGAISVRNLPRPPDRLFLFHGIMRPS
FT                   RGIYAKLIATGQKPPTHFHPSQWEFFRVLRGNLTIDFNGRAIHRTASDGELAVPPFTHH
FT                   VIYGTPGTEMNEVEFVVSASDPAAEQQGATVMDQPFFENWYGYQEDVFQRGEKLDFIQV
FT                   LSMFDAGGTYLSPPWWVPFRSWVGLFLGIVVGRWIGGLLGYAPFYPEWTTDWEAACETM
FT                   QQSWFQRRFADPQAQERARERFRGQLEQEASAKGGKSV"
     atggctccct gcaaacctcg taccttcaca gccggtcaag tcccgctgac aaaatttgat        60
     ggagccattt cggtccgtaa tctaccccgg cccccggacc gcttgttcct gtttcacggt       120
     atcatgaggc caagtcgcgg catctatgcc aagctgatcg ccaccggcca aaaacccccc       180
     acacattttc acccctccca gtgggagttc ttccgcgttc ttcgcgggaa ccttactatc       240
     gatttcaatg gacgtgccat tcaccggacc gcgagtgatg gtgaactggc agtgcctcct       300
     tttacccatc atgtcattta tggaaccccg ggaacggaga tgaatgaggt cgaatttgtc       360
     gtgagtgcca gtgatcctgc tgcggaacag cagggtgcca cggttatgga ccaaccgttc       420
     tttgagaatt ggtatgggta tcaagaggat gtttttcagc ggggggagaa gttggacttc       480
     atacaggtgc tttcgatgtt tgatgccgga ggcacgtatc tatccccgcc gtggtgggtc       540
     cccttccgct cctgggtcgg cctgtttctc gggattgtgg tgggccggtg gataggcggg       600
     ctgctaggct atgcgccttt ttatcctgag tggacaaccg actgggaggc agcctgtgag       660
     acaatgcagc agagctggtt tcaacgtaga ttcgcggatc cacaggcaca ggaaagagca       720
     cgggaaaggt ttcgtggtca gttggagcag gaggcatcgg ccaaaggggg gaagtcagtg       780
     tag                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page