(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE330

PENCW_13.PE330       Location/Qualifiers
FT   CDS_pept        join(complement(748576..748597),complement(748480..748501),
FT                   complement(747889..748384),complement(747678..747833),
FT                   complement(747192..747449))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208395" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947694"
FT                   /orf_name="Pc16g03300"
FT                   /product="Pc16g03300 protein"
FT                   /protein_id="CAP93000.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI0001831DCA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7N5"
FT                   /transl_table=1
FT                   /translation="MSVILCTAGYDHTIRFWEALSGICSRTIQHPDSQVNRLCITPDKR
FT                   FLAAAGHNNVKLFDIKSTNPNPVITFEGHTNNITGVAFHCEGKWMVTSSEDGTVKVWDT
FT                   RTGSLQRNYVHRAAVNDVVIHPNQGELISGDHAGMVRVWDLGESVCTHQLIPEEDTAVL
FT                   SVSVASDGSLLCAGNKKGNVYLWRMVQTDDTTRIIPVCTFQAHKDYLTRVLLSPDVKHL
FT                   ATCSADHTAKTFTSSPDGPPMDPVNHTLFLETTLANHQRWVWDCAFSADSAYLVTVSSD
FT                   HYARLWELGTGNIIRQYSGHHRGAVCVALNDYSEPR"
     atgagtgtca tcctatgcac cgcggggtac gaccatacca ttcgcttttg ggaagcgctc        60
     tcgggtatct gttcgcgtac aatccagcat ccagactcgc aagtcaatcg tctgtgcatc       120
     acaccggata agcggttctt ggctgccgcg ggtcacaaca atgtgaagct gtttgatatc       180
     aagtcaacca atcctaatcc cgtgattaca tttgaaggtc acacaaacaa catcaccggc       240
     gtggcattcc actgtgaggg gaaatggatg gttaccagct ccgaggacgg aactgtgaag       300
     gtctgggata ctcgtaccgg tagcttgcag cggaactacg ttcaccgggc tgcggtcaat       360
     gacgtggtca ttcatcccaa tcagggcgag ctcatcagtg gtgaccacgc cggtatggtc       420
     cgtgtctggg acttgggcga gagtgtctgt actcatcaat tgatcccgga ggaggatact       480
     gcggttctca gtgttagcgt cgccagtgac ggatcgttgc tttgcgctgg aaataagaag       540
     ggcaatgtgt acttgtggcg catggttcaa accgacgaca ccacccgcat cattcccgtc       600
     tgtaccttcc aagctcataa ggactacctc actcgtgttc tcctctctcc cgatgtcaag       660
     caccttgcaa cctgctccgc agatcatact gccaagacat tcacctcatc cccggacggg       720
     cctcctatgg atccagtcaa ccacacactg ttcctggaga ctacgctcgc caatcaccag       780
     cgctgggtct gggactgtgc cttctccgca gacagtgcat atcttgtaac agtctctagt       840
     gatcactacg ctcgcttgtg ggagctcggc actggcaata tcatccgcca gtacagcggc       900
     catcatcgag gcgccgtttg tgttgctttg aacgactact ctgagcctcg ctag             954
//

If you have problems or comments...

PBIL Back to PBIL home page