(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE333

PENCW_13.PE333       Location/Qualifiers
FT   CDS_pept        join(754317..754499,754567..755292)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217034" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671658"
FT                   /orf_name="Pc16g03330"
FT                   /product="Pc16g03330 protein"
FT                   /protein_id="CAP93003.1"
FT                   /db_xref="UniParc:UPI0001831E9D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7N8"
FT                   /transl_table=1
FT                   /translation="MPLRIIEGESPEPVPWGSLPLDIYLLSEWETPHPSQPTESPSARR
FT                   RRLIRQFLALGLEGRRPYQARTETPPTPTKAQIAEILLPVRPEALRPYAAYTTCLEEGL
FT                   WLRLCYKKEEAHESIWSHNEDVAYVGPDGVVLDDEEIFGGLDLAAALEIFPERVTNGGS
FT                   SGHIKLREETLREILGDLEDDTGSGEEDYSDDIKEKVAEFRASRAKNPLLKYGLYHAAC
FT                   VVTHAFVEDEVALDGGGLLHVFWDDCGNVVRQWRVEDDGAEDNFDGAWAEGAWKENFIN
FT                   GIGELGPAYHEGGMRGPPYNV"
     atgcctctcc gaattataga gggcgagtca cccgaaccgg tcccctgggg atccctccca        60
     ttagatatct atcttctctc agaatgggaa acacctcatc cctcgcaacc caccgagtcc       120
     ccctcagccc gccgccgacg gcttatacgc cagttcctcg cattaggttt ggagggcaga       180
     aggccctacc aagcccgcac agaaacacca cccacaccta ctaaggccca aatagccgag       240
     atcctcctcc cagtacgccc ggaggcccta cgtccttacg ctgcctatac cacctgtcta       300
     gaggaaggcc tctggctccg tctctgctac aaaaaagaag aggcgcatga atctatatgg       360
     tcccacaatg aagacgtagc ctacgtcggt cccgatgggg tagtcctcga cgatgaagag       420
     atctttggtg gtctagactt ggcagccgcg ctagaaattt ttcccgagcg tgtcacgaat       480
     ggaggttctt caggacatat caagttgaga gaggagactt tgagagagat actgggtgat       540
     ttagaggatg atacgggatc tggtgaggag gactattctg atgatatcaa ggagaaggta       600
     gcagagttta gggcatcccg cgcgaagaat ccgcttctga agtatggtct atatcatgct       660
     gcctgtgttg ttacacatgc ttttgtggaa gatgaggtgg cgcttgacgg tgggggcttg       720
     ctgcatgtgt tttgggatga ttgtgggaat gttgtgaggc agtggcgggt ggaggatgat       780
     ggagcagagg acaactttga tggagcttgg gcggagggtg cttggaaaga gaatttcatc       840
     aatgggatag gagagcttgg tccagcttat catgagggtg gaatgagagg accaccgtac       900
     aacgtctga                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page